StarFunc result for job id Q9Y2K5

User Input

>input (976 residues)
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEEIEKECEDTSLRQETQRRTSN
HGHARKRAKSNSKLKLVRSLAVCEESSTPFADGPLETQDIIQLHISCPSDKEEEKSTKDV
SEKEDKDKNKEKIPRKMLSRDSSQEYTDSTGIDLHEFLVNTLKKNPRDRMMLLKLEQEIL
EFINDNNNQFKKFPQMTSYHRMLLHRVAAYFGMDHNVDQTGKAVIINKTSNTRIPEQRFS
EHIKDEKNTEFQQRFILKRDDASMDRDDNQTGQNGYLNDIRLSKEAFSSSSHKRRQIFRG
NREGLSRTSSSRQSSTDSELKSLEPRPWSSTDSDGSVRSMRPPVTKASSFSGISILTRGD
SIGSSKGGSAGRISRPGMALGAPEVCNQVTSSQSVRGLLPCTAQQQQQQQQQQLPALPPT
PQQQPPLNNHMISQADDLSNPFGQMSLSRQGSTEAADPSAALFQTPLISQHPQQTSFIMA
STGQPLPTSNYSTSSHAPPTQQVLPPQGYMQPPQQIQVSYYPPGQYPNSNQQYRPLSHPV
AYSPQRGQQLPQPSQQPGLQPMMPNQQQAAYQGMIGVQQPQNQGLLSSQRSSMGGQMQGL
VVQYTPLPSYQVPVGSDSQNVVQPPFQQPMLVPVSQSVQGGLPAAGVPVYYSMIPPAQQN
GTSPSVGFLQPPGSEQYQMPQSPSPCSPPQMPQQYSGVSPSGPGVVVMQLNVPNGPQPPQ
NPSMVQWSHCKYYSMDQRGQKPGDLYSPDSSPQANTQMSSSPVTSPTQSPAPSPVTSLSS
VCTGLSPLPVLTQFPRPGGPAQGDGRYSLLGQPLQYNLSICPPLLHGQSTYTVHQGQSGL
KHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEGITRTEADKLFTQLAMSGAKIQWL
KDAQGLPGGGGGDNSGTAENGRHSDLAALYTIVAVFPSPLAAQNASLRLNNSVSRFKLRM
AKKNYDLRILERASSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2K5	0.999	0.999	0.000	976	1.000	1.000	Q9Y2K5.pdb.gz	R3HD2_HUMAN R3H domain-containing protein 2 OS=Homo sapiens OX=9606 GN=R3HDM2 PE=1 SV=3
2	AFDB:Q15032	0.231	0.211	9.749E-62	1099	0.535	0.475	Q15032.pdb.gz	R3HD1_HUMAN R3H domain-containing protein 1 OS=Homo sapiens OX=9606 GN=R3HDM1 PE=1 SV=3
3	AFDB:Q9UBL0	0.121	0.143	2.218E-33	812	0.352	0.424	Q9UBL0.pdb.gz	ARP21_HUMAN cAMP-regulated phosphoprotein 21 OS=Homo sapiens OX=9606 GN=ARPP21 PE=1 SV=2
4	AFDB:Q8MSX1	0.117	0.067	2.254E-12	1818	0.210	0.113	Q8MSX1.pdb.gz	ENC_DROME Protein encore OS=Drosophila melanogaster OX=7227 GN=enc PE=1 SV=2
5	AFDB:Q9JIX8	0.064	0.048	3.171E-3	1338	0.147	0.107	Q9JIX8.pdb.gz	ACINU_MOUSE Apoptotic chromatin condensation inducer in the nucleus OS=Mus musculus OX=10090 GN=Acin1 PE=1 SV=3
6	AFDB:Q9UKV3	0.063	0.047	4.281E-3	1341	0.157	0.114	Q9UKV3.pdb.gz	ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2
7	AFDB:Q69ZZ9	0.053	0.053	1.118E-2	979	0.138	0.138	Q69ZZ9.pdb.gz	K0754_MOUSE Microtubule-actin cross-linking factor 1, isoforms 6/7 OS=Mus musculus OX=10090 GN=Macf1 PE=2 SV=3
8	PDB:6exnY	0.072	0.639	1.506E-2	87	0.016	0.184	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
9	PDB:3lqvB	0.071	0.427	1.914E-2	115	0.022	0.183	3lqvB.pdb.gz	Branch Recognition by SF3b14
10	PDB:7ohxo	0.065	0.412	1.914E-2	112	0.018	0.161	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
11	PDB:6ff7X	0.077	0.373	3.093E-2	171	0.015	0.088	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
12	PDB:5xjcw	0.070	0.556	3.285E-2	91	0.017	0.187	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
13	AFDB:O75417	0.047	0.023	4.188E-2	2590	0.145	0.055	O75417.pdb.gz	DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens OX=9606 GN=POLQ PE=1 SV=2
14	PDB:5lsbA	0.064	0.296	5.637E-2	176	0.022	0.119	5lsbA.pdb.gz
15	PDB:7c06A	0.072	0.298	5.986E-2	193	0.017	0.088	7c06A.pdb.gz	Elucidation of the aberrant 3' splice site selection by cancer-associated mutations on the U2AF1.
16	AFDB:P13002	0.041	0.032	6.374E-2	1333	0.143	0.105	P13002.pdb.gz	ELF1_DROME Protein grainyhead OS=Drosophila melanogaster OX=7227 GN=grh PE=1 SV=3
17	PDB:6n7pA	0.071	0.314	6.750E-2	186	0.014	0.075	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
18	PDB:6r5kH	0.064	0.144	7.167E-2	394	0.018	0.046	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
19	PDB:5gm6V	0.077	0.454	8.081E-2	128	0.011	0.086	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	AFDB:O00512	0.042	0.033	8.103E-2	1426	0.165	0.113	O00512.pdb.gz	BCL9_HUMAN B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2K5	0.0	1990	976	1.000	1.000	R3HD2_HUMAN R3H domain-containing protein 2 OS=Homo sapiens OX=9606 GN=R3HDM2 PE=1 SV=3
2	Q15032	4.77e-143	456	1099	0.288	0.256	R3HD1_HUMAN R3H domain-containing protein 1 OS=Homo sapiens OX=9606 GN=R3HDM1 PE=1 SV=3
3	Q9DCB4	6.47e-109	358	807	0.198	0.239	ARP21_MOUSE cAMP-regulated phosphoprotein 21 OS=Mus musculus OX=10090 GN=Arpp21 PE=1 SV=2
4	Q9UBL0	2.47e-108	357	812	0.202	0.243	ARP21_HUMAN cAMP-regulated phosphoprotein 21 OS=Homo sapiens OX=9606 GN=ARPP21 PE=1 SV=2
5	Q8MSX1	2.14e-30	132	1818	0.076	0.041	ENC_DROME Protein encore OS=Drosophila melanogaster OX=7227 GN=enc PE=1 SV=2
6	Q9N4P3	1.27e-25	115	558	0.055	0.097	Q9N4P3_CAEEL R3H domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_ZK121.2 PE=1 SV=1
7	Q05672	1.03e-06	54.7	457	0.025	0.053	RBS1_YEAST RNA-binding suppressor of PAS kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RBS1 PE=1 SV=1
8	Q93YN3	6.17e-06	51.6	324	0.034	0.102	Q93YN3_ARATH Single-stranded nucleic acid binding R3H protein OS=Arabidopsis thaliana OX=3702 GN=MUG134 PE=1 SV=1
9	Q9UGR2	2.2	34.7	977	0.050	0.050	Z3H7B_HUMAN Zinc finger CCCH domain-containing protein 7B OS=Homo sapiens OX=9606 GN=ZC3H7B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01424 R3H	9e-07	40.1	R3H domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317903

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392371	0.794	Zinc finger and SCAN domain-containing protein 30
2	9606.ENSP00000308716	0.783	Inhibin beta C chain
3	9606.ENSP00000300101	0.722	Zinc finger and BTB domain-containing protein 39
4	9606.ENSP00000482364	0.707	Transmembrane protein 99
5	9606.ENSP00000369270	0.644	Ras-responsive element-binding protein 1
6	9606.ENSP00000470323	0.643	Zinc finger protein 329
7	9606.ENSP00000480707	0.625	Coatomer subunit zeta-2
8	9606.ENSP00000387185	0.622	Protein-glucosylgalactosylhydroxylysine glucosidase
9	9606.ENSP00000400099	0.622	Rho family-interacting cell polarization regulator 1
10	9606.ENSP00000244527	0.600	Sodium-dependent phosphate transport protein 1
11	9606.ENSP00000331983	0.599	F-actin-uncapping protein LRRC16A
12	9606.ENSP00000264784	0.598	Solute carrier family 2, facilitated glucose transporter member 9
13	9606.ENSP00000394485	0.583	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
14	9606.ENSP00000264645	0.573	Protein CASC3
15	9606.ENSP00000248984	0.558	Uncharacterized protein C22orf24
16	9606.ENSP00000301891	0.556	Solute carrier family 22 member 11
17	9606.ENSP00000469142	0.553	Neuronal PAS domain-containing protein 1
18	9606.ENSP00000379156	0.539	Myosin phosphatase Rho-interacting protein
19	9606.ENSP00000404247	0.519	ADP-ribosylation factor-like protein 17
20	9606.ENSP00000479243	0.518	Endothelial cell-specific chemotaxis regulator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.937	biological regulation
GO:0050789	0.924	regulation of biological process
GO:0050896	0.696	response to stimulus
GO:0050794	0.603	regulation of cellular process
GO:0006950	0.441	response to stress
GO:0051716	0.438	cellular response to stimulus
GO:0019222	0.397	regulation of metabolic process
GO:0060255	0.377	regulation of macromolecule metabolic process
GO:0009628	0.376	response to abiotic stimulus
GO:0009266	0.364	response to temperature stimulus
GO:0071704	0.345	organic substance metabolic process
GO:0009408	0.342	response to heat
GO:0033554	0.318	cellular response to stress
GO:0051171	0.316	regulation of nitrogen compound metabolic process
GO:0034605	0.309	cellular response to heat

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.904	organelle
GO:0043229	0.822	intracellular organelle
GO:0043227	0.795	membrane-bounded organelle
GO:0005829	0.732	cytosol
GO:0043231	0.686	intracellular membrane-bounded organelle
GO:0005634	0.498	nucleus
GO:0005654	0.461	nucleoplasm
GO:0016020	0.433	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]