StarFunc result for job id Q9Y2K6

User Input

>input (914 residues)
MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADH
STIHAQAKKHNLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLK
AVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM
DQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGR
GGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALDDQ
PAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPS
YVLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIP
GKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLE
DCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKIN
SHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFD
DQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAAMREPSLLRFYVSREWLNKF
NTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVC
SICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPP
GPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYGGGPEIAIRQSVAQPLGPEN
LHGEQKIEAETRAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R8A9	0.789	0.788	0.000	916	0.998	0.996	A0A024R8A9.pdb.gz
2	AFDB:A5PN09	0.669	0.671	0.000	911	0.767	0.769	A5PN09.pdb.gz	UBP20_DANRE Ubiquitin carboxyl-terminal hydrolase 20 OS=Danio rerio OX=7955 GN=usp20 PE=3 SV=1
3	AFDB:Q8TEY7	0.754	0.733	0.000	942	0.594	0.576	Q8TEY7.pdb.gz	UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens OX=9606 GN=USP33 PE=1 SV=2
4	AFDB:Q9VVR1	0.325	0.578	8.265E-33	496	0.148	0.272	Q9VVR1.pdb.gz	NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster OX=7227 GN=not PE=1 SV=4
5	AFDB:Q6PAW2	0.262	0.265	1.504E-27	901	0.177	0.180	Q6PAW2.pdb.gz	UBP16_XENLA Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus laevis OX=8355 GN=usp16 PE=2 SV=1
6	AFDB:Q9W462	0.306	0.486	6.971E-26	558	0.121	0.199	Q9W462.pdb.gz	UBP30_DROME Ubiquitin carboxyl-terminal hydrolase 30 homolog OS=Drosophila melanogaster OX=7227 GN=Usp30 PE=2 SV=1
7	PDB:3mhsA	0.303	0.587	2.715E-25	455	0.120	0.242	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
8	AFDB:O22207	0.330	0.327	2.896E-24	924	0.146	0.144	O22207.pdb.gz	UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana OX=3702 GN=UBP5 PE=1 SV=2
9	AFDB:P39538	0.327	0.240	1.671E-22	1254	0.158	0.115	P39538.pdb.gz	UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP12 PE=1 SV=1
10	PDB:5cvnB	0.294	0.810	3.372E-22	321	0.105	0.299	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
11	PDB:4fjcE	0.257	0.515	7.672E-22	434	0.118	0.249	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
12	PDB:5k16B	0.290	0.761	4.427E-20	328	0.107	0.299	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
13	PDB:4wa6D	0.255	0.541	7.250E-20	415	0.113	0.248	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
14	PDB:3ihpB	0.286	0.381	2.853E-19	681	0.115	0.154	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
15	PDB:8a9kD	0.260	0.790	4.932E-18	285	0.096	0.309	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
16	AFDB:A0A024R8V6	0.296	0.242	1.134E-17	1123	0.117	0.095	A0A024R8V6.pdb.gz
17	PDB:7ay1D	0.292	0.744	2.166E-17	341	0.109	0.293	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
18	PDB:3jcrV	0.267	0.537	1.396E-16	431	0.125	0.265	3jcrV.pdb.gz
19	PDB:7yxxA	0.283	0.152	1.558E-16	1754	0.109	0.057	7yxxA.pdb.gz
20	AFDB:P35125	0.276	0.182	3.207E-15	1406	0.161	0.105	P35125.pdb.gz	UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens OX=9606 GN=USP6 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5PN09	0.0	1402	911	0.766	0.768	UBP20_DANRE Ubiquitin carboxyl-terminal hydrolase 20 OS=Danio rerio OX=7955 GN=usp20 PE=3 SV=1
2	Q8R5K2	0.0	1108	909	0.600	0.603	UBP33_MOUSE Ubiquitin carboxyl-terminal hydrolase 33 OS=Mus musculus OX=10090 GN=Usp33 PE=1 SV=2
3	Q8TEY7	0.0	1120	942	0.605	0.587	UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens OX=9606 GN=USP33 PE=1 SV=2
4	Q9Y2K6	0.0	1907	914	1.000	1.000	UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapiens OX=9606 GN=USP20 PE=1 SV=2
5	Q7JW61	1.34e-156	487	975	0.267	0.250	Q7JW61_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp20-33 PE=2 SV=1
6	Q8MSP3	8.08e-156	485	990	0.267	0.246	Q8MSP3_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp20-33 PE=2 SV=1
7	Q8T0I2	1.32e-82	277	508	0.139	0.250	Q8T0I2_DROME HL02756p OS=Drosophila melanogaster OX=7227 GN=Usp20-33 PE=2 SV=1
8	E9PQP0	7.88e-57	196	202	0.109	0.495	E9PQP0_HUMAN ubiquitinyl hydrolase 1 (Fragment) OS=Homo sapiens OX=9606 GN=USP33 PE=1 SV=1
9	O57429	1.25e-31	129	357	0.089	0.227	UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus OX=9031 GN=USP2 PE=2 SV=1
10	Q80U87	1.71e-29	129	1080	0.083	0.070	UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus OX=10090 GN=Usp8 PE=1 SV=2
11	D3ZN39	2.61e-29	128	1081	0.082	0.069	D3ZN39_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=2
12	P40818	1.27e-28	126	1118	0.081	0.066	UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1
13	O22207	1.59e-28	125	924	0.062	0.062	UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana OX=3702 GN=UBP5 PE=1 SV=2
14	Q5U349	1.89e-28	124	618	0.088	0.129	UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus OX=10116 GN=Usp2 PE=1 SV=1
15	O88623	3.05e-28	123	619	0.088	0.129	UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus OX=10090 GN=Usp2 PE=1 SV=3
16	H1UUC2	1.77e-27	117	367	0.075	0.188	H1UUC2_DROME FI18309p1 OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
17	O75604	2.85e-27	120	605	0.086	0.131	UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens OX=9606 GN=USP2 PE=1 SV=2
18	Q9VDD8	5.23e-27	120	896	0.074	0.076	Q9VDD8_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=1 SV=2
19	Q8MQX4	7.07e-27	120	896	0.074	0.076	Q8MQX4_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
20	H0YLB7	9.95e-27	116	431	0.095	0.202	H0YLB7_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06337 DUSP	3.6e-23	93.3	DUSP domain
2	PF00443 UCH	1.9e-63	226.2	Ubiquitin carboxyl-terminal hydrolase
3	PF13423 UCH_1	2.2e-10	52.3	Ubiquitin carboxyl-terminal hydrolase
4	PF02148 zf-UBP	8.8e-12	56.5	Zn-finger in ubiquitin-hydrolases and other protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313811

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359829	0.927	Ubiquitin carboxyl-terminal hydrolase 33
2	9606.ENSP00000305372	0.877	Beta-2 adrenergic receptor
3	9606.ENSP00000261609	0.869	E3 ubiquitin-protein ligase HERC2
4	9606.ENSP00000382390	0.814	Neuralized-like protein 4
5	9606.ENSP00000262394	0.801	WD repeat and SOCS box-containing protein 1
6	9606.ENSP00000320171	0.781	Pyruvate kinase PKM
7	9606.ENSP00000433623	0.764	TNF receptor-associated factor 6
8	9606.ENSP00000312995	0.743	Claspin
9	9606.ENSP00000441543	0.735	Polyubiquitin-C
10	9606.ENSP00000003302	0.717	Ubiquitin carboxyl-terminal hydrolase 28
11	9606.ENSP00000261601	0.706	Ubiquitin carboxyl-terminal hydrolase 14
12	9606.ENSP00000229268	0.705	Ubiquitin carboxyl-terminal hydrolase 5
13	9606.ENSP00000417175	0.687	Vesicle-associated membrane protein-associated protein B/C
14	9606.ENSP00000216133	0.686	Chromobox protein homolog 7
15	9606.ENSP00000312277	0.682	Zinc finger protein 507
16	9606.ENSP00000360994	0.670	AMSH-like protease
17	9606.ENSP00000263966	0.669	Ubiquitin carboxyl-terminal hydrolase 13
18	9606.ENSP00000356774	0.661	Jouberin
19	9606.ENSP00000256474	0.660	Von Hippel-Lindau disease tumor suppressor
20	9606.ENSP00000232501	0.654	GATOR complex protein NPRL2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004843	0.997	cysteine-type deubiquitinase activity
GO:0001664	0.637	G protein-coupled receptor binding
GO:0019899	0.506	enzyme binding
GO:0004197	0.421	cysteine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0070647	0.992	protein modification by small protein conjugation or removal
GO:0050794	0.988	regulation of cellular process
GO:0006508	0.981	proteolysis
GO:0048583	0.970	regulation of response to stimulus
GO:0023051	0.969	regulation of signaling
GO:0010646	0.969	regulation of cell communication
GO:0009966	0.941	regulation of signal transduction
GO:0016579	0.932	protein deubiquitination
GO:0009987	0.701	cellular process
GO:0008277	0.639	regulation of G protein-coupled receptor signaling pathway
GO:0050896	0.490	response to stimulus
GO:0019222	0.396	regulation of metabolic process
GO:0031323	0.305	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0005829	0.997	cytosol
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0005634	0.879	nucleus
GO:0005856	0.843	cytoskeleton
GO:0015630	0.823	microtubule cytoskeleton
GO:0005815	0.799	microtubule organizing center
GO:0005813	0.660	centrosome
GO:0012505	0.534	endomembrane system
GO:0070013	0.469	intracellular organelle lumen
GO:0031981	0.449	nuclear lumen
GO:0005654	0.391	nucleoplasm
GO:0140535	0.385	intracellular protein-containing complex
GO:1990234	0.381	transferase complex
GO:0000151	0.357	ubiquitin ligase complex
GO:0005794	0.352	Golgi apparatus
GO:0030891	0.351	VCB complex
GO:0005925	0.337	focal adhesion
GO:0048471	0.332	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	0.997	ubiquitinyl hydrolase 1.
EC:3.4.22.-	0.421	Cysteine endopeptidases.

[back to server]