StarFunc result for job id Q9Y2K7

User Input

>input (1162 residues)
MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGK
DFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIE
MTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKES
QTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHN
LELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFL
HSFNIPMQLKIYNIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKEFQKESLS
MDLELNGLESGNGDEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKT
LAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPT
GIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKP
HTMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRM
KQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEG
LLNEELPNCWECPKCYQEDSSEKAQKRKMEESDEEAVQAKVLRPLRSCDEPLTPPPHSPT
SMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNP
SGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITASSANLRHSPRVLVQHC
PARTPQRGDEEGLGGEEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMS
VFRYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLS
WTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIR
DLLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQ
SSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHF
ISDLSINSLYCLSDEKLIQKIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IH56	0.468	0.425	0.000	1295	0.529	0.475	A0A0R4IH56.pdb.gz	A0A0R4IH56_DANRE Lysine (K)-specific demethylase 2Aa OS=Danio rerio OX=7955 GN=jhdm1A-b PE=1 SV=1
2	AFDB:A0A0R4IHI9	0.382	0.362	0.000	1234	0.514	0.484	A0A0R4IHI9.pdb.gz
3	AFDB:B8A652	0.404	0.381	0.000	1242	0.520	0.486	B8A652.pdb.gz
4	AFDB:F6P9Q3	0.371	0.343	0.000	1260	0.509	0.469	F6P9Q3.pdb.gz	F6P9Q3_DANRE Lysine (K)-specific demethylase 2Bb OS=Danio rerio OX=7955 GN=LOC100536129 PE=4 SV=1
5	AFDB:I3VM53	0.507	0.507	0.000	1162	1.000	1.000	I3VM53.pdb.gz	I3VM53_HUMAN F-box and leucine-rich repeat protein 11, isoform CRA_a OS=Homo sapiens OX=9606 GN=KDM2A PE=2 SV=1
6	AFDB:Q8NHM5	0.365	0.319	0.000	1336	0.544	0.473	Q8NHM5.pdb.gz	KDM2B_HUMAN Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B PE=1 SV=1
7	AFDB:Q9VHH9	0.343	0.300	1.833E-94	1345	0.377	0.326	Q9VHH9.pdb.gz	JHD1_DROME JmjC domain-containing histone demethylation protein 1 OS=Drosophila melanogaster OX=7227 GN=Kdm2 PE=1 SV=2
8	AFDB:Q9GYI0	0.244	0.310	1.518E-27	910	0.127	0.162	Q9GYI0.pdb.gz	KDM7_CAEEL Lysine-specific demethylase 7 homolog OS=Caenorhabditis elegans OX=6239 GN=jmjd-1.2 PE=1 SV=1
9	AFDB:P40034	0.249	0.570	5.000E-27	492	0.102	0.240	P40034.pdb.gz	JHD1_YEAST JmjC domain-containing histone demethylation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JHD1 PE=1 SV=1
10	PDB:6o60C	0.186	0.524	5.324E-12	389	0.051	0.152	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
11	AFDB:P39956	0.141	0.196	5.573E-9	796	0.084	0.123	P39956.pdb.gz	RPH1_YEAST DNA damage-responsive transcriptional repressor RPH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPH1 PE=1 SV=1
12	PDB:3al5B	0.162	0.536	1.531E-8	311	0.043	0.161	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
13	PDB:7b5mT	0.169	0.524	2.494E-8	325	0.052	0.188	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
14	PDB:4b7eA	0.153	0.453	4.526E-8	349	0.032	0.106	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
15	PDB:7yxgA	0.157	0.501	5.324E-8	313	0.040	0.150	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
16	PDB:4qszA	0.139	0.223	7.369E-8	686	0.034	0.058	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
17	PDB:5nfnB	0.147	0.464	8.670E-8	318	0.030	0.110	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
18	PDB:3al5C	0.150	0.530	3.546E-7	284	0.046	0.187	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
19	PDB:1a4yA	0.149	0.354	2.494E-6	460	0.039	0.098	1a4yA.pdb.gz
20	PDB:7pmkL	0.110	0.212	9.663E-6	475	0.037	0.091	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IH56	0.0	801	1295	0.347	0.311	A0A0R4IH56_DANRE Lysine (K)-specific demethylase 2Aa OS=Danio rerio OX=7955 GN=jhdm1A-b PE=1 SV=1
2	F6P9Q3	0.0	774	1260	0.331	0.306	F6P9Q3_DANRE Lysine (K)-specific demethylase 2Bb OS=Danio rerio OX=7955 GN=LOC100536129 PE=4 SV=1
3	I3VM53	0.0	2412	1162	1.000	1.000	I3VM53_HUMAN F-box and leucine-rich repeat protein 11, isoform CRA_a OS=Homo sapiens OX=9606 GN=KDM2A PE=2 SV=1
4	I3VM54	0.0	2380	1145	0.985	1.000	I3VM54_HUMAN Lysine demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A PE=1 SV=1
5	P59997	0.0	2350	1161	0.972	0.972	KDM2A_MOUSE Lysine-specific demethylase 2A OS=Mus musculus OX=10090 GN=Kdm2a PE=1 SV=2
6	Q6P1G2	0.0	792	1309	0.356	0.316	KDM2B_MOUSE Lysine-specific demethylase 2B OS=Mus musculus OX=10090 GN=Kdm2b PE=1 SV=1
7	Q8NHM5	0.0	806	1336	0.356	0.310	KDM2B_HUMAN Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B PE=1 SV=1
8	Q9Y2K7	0.0	2412	1162	1.000	1.000	KDM2A_HUMAN Lysine-specific demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A PE=1 SV=3
9	Q9VHH9	1.15e-134	445	1345	0.180	0.155	JHD1_DROME JmjC domain-containing histone demethylation protein 1 OS=Drosophila melanogaster OX=7227 GN=Kdm2 PE=1 SV=2
10	A0A0C4DGG3	1.79e-124	400	704	0.161	0.266	A0A0C4DGG3_HUMAN Lysine demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B PE=1 SV=1
11	Q6PB97	2.99e-86	296	674	0.123	0.212	FXL19_MOUSE F-box/LRR-repeat protein 19 OS=Mus musculus OX=10090 GN=Fbxl19 PE=1 SV=1
12	Q6PCT2	4.34e-86	296	694	0.123	0.206	FXL19_HUMAN F-box/LRR-repeat protein 19 OS=Homo sapiens OX=9606 GN=FBXL19 PE=1 SV=3
13	H0Y3N9	2.48e-82	293	1049	0.120	0.133	H0Y3N9_HUMAN PHD finger protein 8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=2
14	Q9UPP1	2.69e-82	293	1060	0.120	0.132	PHF8_HUMAN Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=3
15	Q63ZQ7	6.73e-82	282	619	0.116	0.218	Q63ZQ7_XENLA F-box and leucine-rich repeat protein 19 S homeolog OS=Xenopus laevis OX=8355 GN=fbxl19.S PE=2 SV=1
16	P0CH95	3.47e-80	286	1032	0.114	0.129	PHF8_DANRE Histone lysine demethylase PHF8 OS=Danio rerio OX=7955 GN=phf8 PE=1 SV=1
17	Q5RHD1	2.81e-79	281	875	0.108	0.143	KDM7A_DANRE Lysine-specific demethylase 7A OS=Danio rerio OX=7955 GN=kdm7a PE=2 SV=2
18	P0CF52	2.84e-78	271	577	0.114	0.229	KDM7B_DANRE Lysine-specific demethylase 7B OS=Danio rerio OX=7955 GN=jhdm1db PE=2 SV=1
19	Q3UWM4	1.02e-76	275	940	0.112	0.138	KDM7A_MOUSE Lysine-specific demethylase 7A OS=Mus musculus OX=10090 GN=Kdm7a PE=1 SV=2
20	Q6ZMT4	4.85e-76	273	941	0.112	0.138	KDM7A_HUMAN Lysine-specific demethylase 7A OS=Homo sapiens OX=9606 GN=KDM7A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00190 Cupin_1	3.1e+02	12.3	Cupin
2	PF13621 Cupin_8	1e+02	14.1	Cupin-like domain
3	PF00646 F-box	7.7e-06	36.9	F-box domain
4	PF12937 F-box-like	5.6e-05	34.3	F-box-like
5	PF17811 JHD	6e-06	38.0	Jumonji helical domain
6	PF02373 JmjC	0.019	26.8	JmjC domain, hydroxylase
7	PF13516 LRR_6	37	15.8	Leucine Rich repeat
8	PF16866 PHD_4	7e-18	75.8	PHD-finger
9	PF02008 zf-CXXC	2.2e-09	48.5	CXXC zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000432786

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231487	0.993	S-phase kinase-associated protein 1
2	9606.ENSP00000263253	0.902	Histone acetyltransferase p300
3	9606.ENSP00000395929	0.869	Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific
4	9606.ENSP00000301067	0.815	Histone-lysine N-methyltransferase 2D
5	9606.ENSP00000361473	0.782	Lysine-specific demethylase 4A
6	9606.ENSP00000386759	0.777	Histone-lysine N-methyltransferase SETD2
7	9606.ENSP00000383042	0.763	Lysine-specific histone demethylase 1A
8	9606.ENSP00000382688	0.738	Lysine-specific demethylase 5A
9	9606.ENSP00000370710	0.737	Lysine-specific demethylase 4C
10	9606.ENSP00000442382	0.737	Lysine-specific demethylase 4C
11	9606.ENSP00000356480	0.729	E3 ubiquitin-protein ligase RING2
12	9606.ENSP00000159111	0.727	Lysine-specific demethylase 4B
13	9606.ENSP00000367203	0.726	Lysine-specific demethylase 6A
14	9606.ENSP00000398837	0.723	Histone-lysine N-methyltransferase 2B
15	9606.ENSP00000364550	0.713	Lysine-specific demethylase 5C
16	9606.ENSP00000326563	0.710	Lysine-specific demethylase 3B
17	9606.ENSP00000356234	0.710	Lysine-specific demethylase 5B
18	9606.ENSP00000337976	0.705	Histone-lysine N-methyltransferase SUV39H1
19	9606.ENSP00000254846	0.703	Lysine-specific demethylase 6B
20	9606.ENSP00000476960	0.700	Histone cluster 2 H3 pseudogene 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046914	1.000	transition metal ion binding
GO:0032452	1.000	histone demethylase activity
GO:0016706	1.000	2-oxoglutarate-dependent dioxygenase activity
GO:0043565	1.000	sequence-specific DNA binding
GO:0008270	0.987	zinc ion binding
GO:0045322	0.810	unmethylated CpG binding
GO:0051864	0.756	histone H3K36 demethylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0050789	0.996	regulation of biological process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.993	macromolecule metabolic process
GO:0010468	0.992	regulation of gene expression
GO:0048519	0.991	negative regulation of biological process
GO:0009987	0.989	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0048523	0.967	negative regulation of cellular process
GO:0051171	0.803	regulation of nitrogen compound metabolic process
GO:0080090	0.794	regulation of primary metabolic process
GO:0031323	0.794	regulation of cellular metabolic process
GO:0009892	0.727	negative regulation of metabolic process
GO:0010605	0.723	negative regulation of macromolecule metabolic process
GO:0019219	0.686	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.629	positive regulation of biological process
GO:0044237	0.597	cellular metabolic process
GO:0051252	0.569	regulation of RNA metabolic process
GO:0010556	0.557	regulation of macromolecule biosynthetic process
GO:0031326	0.554	regulation of cellular biosynthetic process
GO:0006355	0.511	regulation of DNA-templated transcription
GO:0050896	0.476	response to stimulus
GO:0043412	0.443	macromolecule modification
GO:0019538	0.425	protein metabolic process
GO:0010604	0.422	positive regulation of macromolecule metabolic process
GO:0036211	0.419	protein modification process
GO:0031324	0.412	negative regulation of cellular metabolic process
GO:0051172	0.409	negative regulation of nitrogen compound metabolic process
GO:0044260	0.386	cellular macromolecule metabolic process
GO:0048522	0.379	positive regulation of cellular process
GO:0051716	0.369	cellular response to stimulus
GO:0045934	0.328	negative regulation of nucleobase-containing compound metabolic process
GO:0016570	0.310	histone modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.665	protein-containing complex
GO:0043232	0.538	intracellular non-membrane-bounded organelle
GO:0005737	0.361	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	1.000	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.

[back to server]