StarFunc result for job id Q9Y2L5

User Input

>input (1435 residues)
MAQCVQSVQELIPDSFVPCVAALCSDEAERLTRLNHLSFAELLKPFSRLTSEVHMRDPNN
QLHVIKNLKIAVSNIVTQPPQPGAIRKLLNDVVSGSQPAEGLVANVITAGDYDLNISATT
PWFESYRETFLQSMPALDHEFLNHYLACMLVASSSEAEPVEQFSKLSQEQHRIQHNSDYS
YPKWFIPNTLKYYVLLHDVSAGDEQRAESIYEEMKQKYGTQGCYLLKINSRTSNRASDEQ
IPDPWSQYLQKNSIQNQESYEDGPCTITSNKNSDNNLLSLDGLDNEVKDGLPNNFRAHPL
QLEQSSDPSNSIDGPDHLRSASSLHETKKGNTGIIHGACLTLTDHDRIRQFIQEFTFRGL
LPHIEKTIRQLNDQLISRKGLSRSLFSATKKWFSGSKVPEKSINDLKNTSGLLYPPEAPE
LQIRKMADLCFLVQHYDLAYSCYHTAKKDFLNDQAMLYAAGALEMAAVSAFLQPGAPRPY
PAHYMDTAIQTYRDICKNMVLAERCVLLSAELLKSQSKYSEAAALLIRLTSEDSDLRSAL
LLEQAAHCFINMKSPMVRKYAFHMILAGHRFSKAGQKKHALRCYCQAMQVYKGKGWSLAE
DHINFTIGRQSYTLRQLDNAVSAFRHILINESKQSAAQQGAFLREYLYVYKNVSQLSPDG
PLPQLPLPYINSSATRVFFGHDRRPADGEKQAATHVSLDQEYDSESSQQWRELEEQVVSV
VNKGVIPSNFHPTQYCLNSYSDNSRFPLAVVEEPITVEVAFRNPLKVLLLLTDLSLLWKF
HPKDFSGKDNEEVKQLVTSEPEMIGAEVISEFLINGEESKVARLKLFPHHIGELHILGVV
YNLGTIQGSMTVDGIGALPGCHTGKYSLSMSVRGKQDLEIQGPRLNNTKEEKTSVKYGPD
RRLDPIITEEMPLLEVFFIHFPTGLLCGEIRKAYVEFVNVSKCPLTGLKVVSKRPEFFTF
GGNTAVLTPLSPSASENCSAYKTVVTDATSVCTALISSASSVDFGIGTGSQPEVIPVPLP
DTVLLPGASVQLPMWLRGPDEEGVHEINFLFYYESVKKQPKIRHRILRHTAIICTSRSLN
VRATVCRSNSLENEEGRGGNMLVFVDVENTNTSEAGVKEFHIVQVSSSSKHWKLQKSVNL
SENKDTKLASREKGKFCFKAIRCEKEEAATQSSEKYTFADIIFGNEQIISSASPCADFFY
RSLSSELKKPQAHLPVHTEKQSTEDAVRLIQKCSEVDLNIVILWKAYVVEDSKQLILEGQ
HHVILRTIGKEAFSYPQKQEPPEMELLKFFRPENITVSSRPSVEQLSSLIKTSLHYPESF
NHPFHQKSLCLVPVTLLLSNCSKADVDVIVDLRHKTTSPEALEIHGSFTWLGQTQYKLQL
KSQEIHSLQLKACFVHTGVYNLGTPRVFAKLSDQVTVFETSQQNSMPALIIISNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2L5	1.000	1.000	0.000	1435	1.000	1.000	Q9Y2L5.pdb.gz	TPPC8_HUMAN Trafficking protein particle complex subunit 8 OS=Homo sapiens OX=9606 GN=TRAPPC8 PE=1 SV=2
2	AFDB:Q9VW22	0.678	0.734	1.515E-85	1319	0.270	0.294	Q9VW22.pdb.gz	Q9VW22_DROME FI18195p1 OS=Drosophila melanogaster OX=7227 GN=l(3)76BDm PE=1 SV=2
3	PDB:7u05A	0.200	0.242	1.852E-21	1114	0.109	0.141	7u05A.pdb.gz
4	PDB:7u05B	0.193	0.276	1.667E-10	815	0.072	0.126	7u05B.pdb.gz
5	PDB:7sqcO0	0.093	0.111	3.772E-10	1140	0.069	0.087	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
6	PDB:7ea3J	0.162	0.235	2.723E-9	883	0.071	0.116	7ea3J.pdb.gz
7	PDB:7kmtB	0.240	0.662	3.233E-9	475	0.061	0.185	7kmtB.pdb.gz
8	PDB:7sqcO1	0.083	0.149	7.133E-8	673	0.066	0.141	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
9	AFDB:Q57XV2	0.076	0.054	7.390E-8	2327	0.072	0.045	Q57XV2.pdb.gz	Q57XV2_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.1J15.770 PE=4 SV=1
10	PDB:7nxdA	0.076	0.112	3.350E-7	905	0.044	0.070	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
11	PDB:4nenA	0.071	0.090	2.219E-6	1063	0.054	0.073	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
12	PDB:4g1eA	0.084	0.118	3.717E-6	964	0.039	0.058	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
13	PDB:4nehA	0.072	0.090	4.228E-6	1084	0.059	0.077	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
14	AFDB:Q54NE5	0.059	0.047	6.448E-6	1918	0.062	0.046	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
15	AFDB:A0A0B4K7C1	0.095	0.152	6.731E-6	803	0.050	0.090	A0A0B4K7C1.pdb.gz	A0A0B4K7C1_DROME Aspartyl beta-hydroxylase, isoform H OS=Drosophila melanogaster OX=7227 GN=Asph PE=1 SV=1
16	AFDB:Q5XEY4	0.087	0.194	3.920E-5	564	0.040	0.103	Q5XEY4.pdb.gz	Q5XEY4_ARATH At5g53080 OS=Arabidopsis thaliana OX=3702 GN=WTG1 PE=1 SV=1
17	AFDB:Q8SYD0	0.077	0.249	1.618E-4	369	0.037	0.144	Q8SYD0.pdb.gz	TTC19_DROME Tetratricopeptide repeat protein 19 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Ttc19 PE=2 SV=1
18	AFDB:O81629	0.078	0.165	1.922E-4	609	0.043	0.102	O81629.pdb.gz	KLCR1_ARATH Protein KINESIN LIGHT CHAIN-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=KLCR1 PE=1 SV=1
19	AFDB:Q28056	0.084	0.144	2.186E-4	754	0.041	0.078	Q28056.pdb.gz	ASPH_BOVIN Aspartyl/asparaginyl beta-hydroxylase OS=Bos taurus OX=9913 GN=ASPH PE=1 SV=1
20	AFDB:P33292	0.084	0.166	2.282E-4	576	0.053	0.132	P33292.pdb.gz	PEX5_PICPA Peroxisomal targeting signal receptor OS=Komagataella pastoris OX=4922 GN=PEX5 PE=3 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2L5	0.0	2986	1435	1.000	1.000	TPPC8_HUMAN Trafficking protein particle complex subunit 8 OS=Homo sapiens OX=9606 GN=TRAPPC8 PE=1 SV=2
2	Q9VW22	8.65e-165	533	1319	0.270	0.293	Q9VW22_DROME FI18195p1 OS=Drosophila melanogaster OX=7227 GN=l(3)76BDm PE=1 SV=2
3	O94731	6.53e-15	82.4	658	0.089	0.193	TR851_SCHPO Transport protein particle subunit trs85-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trs85-1 PE=3 SV=1
4	O74748	1.79e-11	71.2	618	0.036	0.084	TR852_SCHPO Transport protein particle subunit trs85-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trs85-2 PE=3 SV=1
5	Q9XI87	0.43	37.4	438	0.026	0.087	VIK_ARATH Serine/threonine-protein kinase VIK OS=Arabidopsis thaliana OX=3702 GN=VIK PE=1 SV=1
6	Q09100	1.2	35.8	369	0.021	0.081	RNP24_SCHPO RNA-binding protein rnp24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rnp24 PE=4 SV=2
7	P08413	1.3	35.8	542	0.022	0.059	KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus OX=10116 GN=Camk2b PE=1 SV=1
8	P28652	1.4	35.8	542	0.022	0.059	KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus OX=10090 GN=Camk2b PE=1 SV=2
9	Q6FV96	3.7	34.3	392	0.020	0.074	Q6FV96_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SNF6 PE=4 SV=1
10	Q586A3	6.0	33.1	273	0.010	0.055	Q586A3_TRYB2 C3H1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.270 PE=4 SV=1
11	O25806	8.5	33.5	2890	0.027	0.013	RPOBC_HELPY Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=rpoBC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12739 TRAPPC-Trs85	3.5e-139	476.0	ER-Golgi trafficking TRAPP I complex 85 kDa subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283351

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392495	0.999	Trafficking protein particle complex subunit 2
2	9606.ENSP00000470262	0.999	Trafficking protein particle complex subunit 5
3	9606.ENSP00000302783	0.998	Trafficking protein particle complex subunit 1
4	9606.ENSP00000324318	0.998	Trafficking protein particle complex subunit 12
5	9606.ENSP00000373979	0.998	Trafficking protein particle complex subunit 9
6	9606.ENSP00000480332	0.998	Trafficking protein particle complex subunit 3
7	9606.ENSP00000006275	0.997	Trafficking protein particle complex subunit 6A
8	9606.ENSP00000436005	0.996	Trafficking protein particle complex subunit 4
9	9606.ENSP00000357591	0.995	Trafficking protein particle complex subunit 3-like protein
10	9606.ENSP00000291574	0.994	Trafficking protein particle complex subunit 10
11	9606.ENSP00000330289	0.993	Trafficking protein particle complex subunit 6B
12	9606.ENSP00000387286	0.993	Ras-related protein Rab-1A
13	9606.ENSP00000469888	0.990	Trafficking protein particle complex 2 pseudogene 1
14	9606.ENSP00000301021	0.989	Trafficking protein particle complex subunit 2-like protein
15	9606.ENSP00000409231	0.983	Belongs to the TRAPPC13 family
16	9606.ENSP00000335371	0.982	Trafficking protein particle complex subunit 11
17	9606.ENSP00000310226	0.970	Ras-related protein Rab-1B
18	9606.ENSP00000394071	0.909	Rab GDP dissociation inhibitor alpha
19	9606.ENSP00000369538	0.908	Rab GDP dissociation inhibitor beta
20	9606.ENSP00000350386	0.906	Rab proteins geranylgeranyltransferase component A 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0010256	0.975	endomembrane system organization
GO:0007030	0.971	Golgi organization
GO:0051179	0.561	localization
GO:0006810	0.385	transport
GO:0016192	0.384	vesicle-mediated transport
GO:0051641	0.355	cellular localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030008	1.000	TRAPP complex
GO:0005829	1.000	cytosol
GO:0012505	0.958	endomembrane system
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0005794	0.663	Golgi apparatus
GO:0016020	0.486	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]