StarFunc result for job id Q9Y2L6

User Input

>input (1034 residues)
MASVFMCGVEDLLFSGSRFVWNLTVSTLRRWYTERLRACHQVLRTWCGLQDVYQMTEGRH
CQVHLLDDRRLELLVQPKLLARELLDLVASHFNLKEKEYFGITFIDDTGQQNWLQLDHRV
LDHDLPKKPGPTILHFAVRFYIESISFLKDKTTVELFFLNAKACVHKGQIEVESETIFKL
AAFILQEAKGDYTSDENARKDLKTLPAFPTKTLQEHPSLAYCEDRVIEHYLKIKGLTRGQ
AVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIGQYDIQDKVKPRKLFQWKQLE
NLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANSSLIKSIWVMAISQHQFYLDR
KQSKAKIPSARSLDEIAMDLTETGTQRASKLVTLETKSQFIMASNGSLISSGSQDSEVSE
EQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLNIGEKPPQVRRR
VGTAFKLDDNLLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKRKQDYTD
AMKKLQEIENAINEYRIRCGKKPSQKATVLPEDIIPSESSSLSDTTTYDDPSDAFTFPGQ
RSSSVPHSPRILPPKSLGIERIHFRKSSINEQFVDTRQSREMLSTHSSPYKTLERRPQGG
RSMPTTPVLTRNAYSSSHLEPESSSQHCRQRSGSLESQSHLLSEMDSDKPFFSLSKSQRS
SSTEILDDGSSYTSQSSTEYYCVTPVTGPYYTTQTLDTRTRGRRRSKKQNVSTSNSGSMP
NLAQKDSLRNGVYSKSQEPPSSSYYIAGYTPYAECDFYYSGGYVYENDTEGQYSVNPSYR
SSAHYGYERQRDYSRSFHEDEVDRVPHNPYATLRLPRKAAAKSEHITKNIHKALVAEHLR
GWYQRASGQKDQGHSPQTSFDSDRGSQRCLGFAGLQVPCSPSSRASSYSSVSSTNASGNW
RTQLTIGLSDYETPAHSSYTSCYGNVYNPLPSPSRQYTEISQLDGTDGNQLEDNLESSEQ
RLFWHEDSKPGTLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q920B0	0.613	0.613	0.000	1035	0.936	0.935	Q920B0.pdb.gz	FRM4B_MOUSE FERM domain-containing protein 4B OS=Mus musculus OX=10090 GN=Frmd4b PE=1 SV=2
2	AFDB:Q9P2Q2	0.433	0.431	2.114E-81	1039	0.465	0.463	Q9P2Q2.pdb.gz	FRM4A_HUMAN FERM domain-containing protein 4A OS=Homo sapiens OX=9606 GN=FRMD4A PE=1 SV=3
3	PDB:4rm8A	0.263	0.692	1.557E-23	368	0.086	0.242	4rm8A.pdb.gz
4	AFDB:Q9V3V3	0.271	0.226	2.306E-20	1252	0.155	0.128	Q9V3V3.pdb.gz	Q9V3V3_DROME Pez, isoform A OS=Drosophila melanogaster OX=7227 GN=Pez PE=2 SV=1
5	AFDB:Q8JG61	0.262	0.179	4.381E-20	1534	0.157	0.106	Q8JG61.pdb.gz	Q8JG61_DANRE Erythrocyte membrane protein band 4.1 (Elliptocytosis 1, RH-linked) OS=Danio rerio OX=7955 GN=epb41 PE=2 SV=1
6	AFDB:Q07436	0.249	0.183	1.013E-13	1427	0.172	0.125	Q07436.pdb.gz	EXPA_DROME Protein expanded OS=Drosophila melanogaster OX=7227 GN=ex PE=1 SV=3
7	AFDB:Q96HB5	0.084	0.117	1.010E-12	630	0.156	0.256	Q96HB5.pdb.gz	CC120_HUMAN Coiled-coil domain-containing protein 120 OS=Homo sapiens OX=9606 GN=CCDC120 PE=1 SV=1
8	AFDB:Q5SYB0	0.248	0.167	4.514E-12	1578	0.141	0.093	Q5SYB0.pdb.gz	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
9	AFDB:Q14CM0	0.249	0.198	6.222E-12	1322	0.137	0.107	Q14CM0.pdb.gz	FRPD4_HUMAN FERM and PDZ domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FRMPD4 PE=1 SV=1
10	AFDB:D3ZW88	0.253	0.195	7.706E-12	1371	0.155	0.117	D3ZW88.pdb.gz	D3ZW88_RAT FERM and PDZ domain containing 1 OS=Rattus norvegicus OX=10116 GN=Frmpd1 PE=4 SV=3
11	AFDB:D4A3K7	0.247	0.154	1.544E-11	1705	0.135	0.082	D4A3K7.pdb.gz	D4A3K7_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=2
12	PDB:7c3mA	0.221	0.379	7.385E-7	577	0.044	0.078	7c3mA.pdb.gz
13	PDB:6r9tA	0.146	0.074	1.647E-6	2185	0.034	0.016	6r9tA.pdb.gz
14	PDB:6pyuA	0.074	0.082	4.772E-4	930	0.023	0.026	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
15	PDB:7lq1A	0.073	0.080	1.123E-3	950	0.022	0.024	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
16	PDB:3dbhI	0.070	0.679	2.250E-3	86	0.013	0.151	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
17	PDB:4f7zA	0.069	0.075	4.758E-3	946	0.030	0.033	4f7zA.pdb.gz
18	PDB:6u3eA	0.082	0.156	5.295E-3	397	0.028	0.073	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
19	PDB:6mdhA	0.070	0.440	5.586E-3	149	0.011	0.074	6mdhA.pdb.gz
20	PDB:7w7gB	0.077	0.048	6.558E-3	1711	0.029	0.018	7w7gB.pdb.gz	Structure and mechanism of NALCN-FAM155A-UNC79-UNC80 channel complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BIE6	0.0	800	1020	0.453	0.459	FRM4A_MOUSE FERM domain-containing protein 4A OS=Mus musculus OX=10090 GN=Frmd4a PE=1 SV=2
2	Q920B0	0.0	1904	1035	0.936	0.935	FRM4B_MOUSE FERM domain-containing protein 4B OS=Mus musculus OX=10090 GN=Frmd4b PE=1 SV=2
3	Q9P2Q2	0.0	783	1039	0.450	0.448	FRM4A_HUMAN FERM domain-containing protein 4A OS=Homo sapiens OX=9606 GN=FRMD4A PE=1 SV=3
4	Q9Y2L6	0.0	2151	1034	1.000	1.000	FRM4B_HUMAN FERM domain-containing protein 4B OS=Homo sapiens OX=9606 GN=FRMD4B PE=1 SV=4
5	Q66I42	1.49e-34	142	579	0.085	0.152	Q66I42_DANRE Moesin OS=Danio rerio OX=7955 GN=rdx PE=1 SV=1
6	T1SRT4	1.81e-34	138	379	0.084	0.230	T1SRT4_RAT Radixin isoform OS=Rattus norvegicus OX=10116 GN=Rdx PE=2 SV=1
7	A0A0G2K095	2.15e-34	142	580	0.084	0.150	A0A0G2K095_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=1 SV=2
8	E9PT65	3.09e-34	142	604	0.084	0.144	E9PT65_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=1 SV=3
9	Q5PQK5	3.34e-34	141	583	0.084	0.149	Q5PQK5_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=4 SV=1
10	Q5WQV5	3.49e-34	141	583	0.084	0.149	Q5WQV5_RAT Radixin OS=Rattus norvegicus OX=10116 PE=1 SV=1
11	A0A8I5ZR70	3.85e-34	141	582	0.086	0.153	A0A8I5ZR70_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=1 SV=1
12	P26043	3.86e-34	141	583	0.084	0.149	RADI_MOUSE Radixin OS=Mus musculus OX=10090 GN=Rdx PE=1 SV=3
13	B0YJ88	4.58e-34	141	583	0.084	0.149	B0YJ88_HUMAN Radixin OS=Homo sapiens OX=9606 GN=RDX PE=2 SV=1
14	P35241	4.58e-34	141	583	0.084	0.149	RADI_HUMAN Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1
15	P31977	9.08e-34	140	586	0.083	0.147	EZRI_RAT Ezrin OS=Rattus norvegicus OX=10116 GN=Ezr PE=1 SV=3
16	P26040	1.07e-33	140	586	0.083	0.147	EZRI_MOUSE Ezrin OS=Mus musculus OX=10090 GN=Ezr PE=1 SV=3
17	P26038	1.85e-33	139	577	0.084	0.151	MOES_HUMAN Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3
18	V9HWC0	1.85e-33	139	577	0.084	0.151	V9HWC0_HUMAN Epididymis luminal protein 70 OS=Homo sapiens OX=9606 GN=HEL70 PE=2 SV=1
19	P15311	2.50e-33	139	586	0.082	0.145	EZRI_HUMAN Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4
20	Q5TZG5	5.29e-33	138	583	0.086	0.153	Q5TZG5_DANRE Ezrin OS=Danio rerio OX=7955 GN=ezr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11819 CUPID	5.5e-52	186.8	Cytohesin Ubiquitin Protein Inducing Domain
2	PF09380 FERM_C	4.4e-19	80.0	FERM C-terminal PH-like domain
3	PF00373 FERM_M	1.4e-15	69.1	FERM central domain
4	PF09379 FERM_N	1.2e-14	65.3	FERM N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381549

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297044	0.956	Cytohesin-3
2	9606.ENSP00000333539	0.768	Mirror-image polydactyly 1
3	9606.ENSP00000343871	0.764	Transmembrane and tetratricopeptide repeat containing 4
4	9606.ENSP00000354398	0.714	Cytohesin-1
5	9606.ENSP00000478878	0.709	Copine-4
6	9606.ENSP00000310111	0.687	Heat shock protein family B member 7
7	9606.ENSP00000344724	0.683	TOX high mobility group box family member 2
8	9606.ENSP00000408236	0.655	Cytohesin-2
9	9606.ENSP00000470383	0.646	Cytohesin-2
10	9606.ENSP00000460236	0.629	Spondin-1
11	9606.ENSP00000356842	0.622	Cell surface A33 antigen
12	9606.ENSP00000222792	0.597	Beta-chimaerin
13	9606.ENSP00000376765	0.582	E3 SUMO-protein ligase PIAS3
14	9606.ENSP00000369681	0.570	Ubiquitin carboxyl-terminal hydrolase 3
15	9606.ENSP00000340937	0.566	Collagen alpha-1(XVII) chain
16	9606.ENSP00000353557	0.551	Solute carrier family 35 member F1
17	9606.ENSP00000479708	0.550	Protein MAL2
18	9606.ENSP00000215531	0.543	Small integral membrane protein 24
19	9606.ENSP00000428518	0.532	GDNF family receptor alpha-2
20	9606.ENSP00000361467	0.527	Disks large homolog 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0065007	0.808	biological regulation
GO:0050789	0.764	regulation of biological process
GO:0050794	0.678	regulation of cellular process
GO:0090162	0.620	establishment of epithelial cell polarity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005737	0.988	cytoplasm
GO:0005576	0.973	extracellular region
GO:0043226	0.956	organelle
GO:0043227	0.928	membrane-bounded organelle
GO:0005615	0.900	extracellular space
GO:0030054	0.891	cell junction
GO:0043231	0.785	intracellular membrane-bounded organelle
GO:0016020	0.595	membrane
GO:0005911	0.576	cell-cell junction
GO:0120025	0.520	plasma membrane bounded cell projection
GO:0031974	0.438	membrane-enclosed lumen
GO:0070013	0.434	intracellular organelle lumen
GO:0005829	0.408	cytosol
GO:0031981	0.393	nuclear lumen
GO:0005654	0.371	nucleoplasm
GO:0005912	0.361	adherens junction
GO:0031252	0.357	cell leading edge
GO:0005923	0.352	bicellular tight junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]