StarFunc result for job id Q9Y2L8

User Input

>input (839 residues)
MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPTFETFYQRFRHFQYHE
ASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPEEFQPWVREHHPESGEE
AVAVIENIQRELEERRQQIVACPDVLPRKMATPGAVQESCSPHPLTVDTQPEQAPQKPRL
LEENALPVLQVPSLPLKDSQELTASLLSTGSQKLVKIEEVADVAVSFILEEWGHLDQSQK
SLYRDDRKENYGSITSMGYESRDNMELIVKQISDDSESHWVAPEHTERSVPQDPDFAEVS
DLKGMVQRWQVNPTVGKSRQNPSQKRDLDAITDISPKQSTHGERGHRCSDCGKFFLQASN
FIQHRRIHTGEKPFKCGECGKSYNQRVHLTQHQRVHTGEKPYKCQVCGKAFRVSSHLVQH
HSVHSGERPYGCNECGKNFGRHSHLIEHLKRHFREKSQRCSDKRSKNTKLSVKKKISEYS
EADMELSGKTQRNVSQVQDFGEGCEFQGKLDRKQGIPMKEILGQPSSKRMNYSEVPYVHK
KSSTGERPHKCNECGKSFIQSAHLIQHQRIHTGEKPFRCEECGKSYNQRVHLTQHQRVHT
GEKPYTCPLCGKAFRVRSHLVQHQSVHSGERPFKCNECGKGFGRRSHLAGHLRLHSREKS
HQCRECGEIFFQYVSLIEHQVLHMGQKNEKNGICEEAYSWNLTVIEDKKIELQEQPYQCD
ICGKAFGYSSDLIQHYRTHTAEKPYQCDICRENVGQCSHTKQHQKIYSSTKSHQCHECGR
GFTLKSHLNQHQRIHTGEKPFQCKECGMNFSWSCSLFKHLRSHERTDPINTLSVEGSLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2L8	1.000	1.000	0.000	839	1.000	1.000	Q9Y2L8.pdb.gz	ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens OX=9606 GN=ZKSCAN5 PE=1 SV=1
2	AFDB:Q9P0L1	0.320	0.352	9.091E-54	754	0.356	0.397	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
3	AFDB:P59923	0.213	0.183	1.711E-42	1031	0.349	0.284	P59923.pdb.gz	ZN445_HUMAN Zinc finger protein 445 OS=Homo sapiens OX=9606 GN=ZNF445 PE=1 SV=1
4	AFDB:Q86WZ6	0.191	0.199	1.456E-41	799	0.277	0.290	Q86WZ6.pdb.gz	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
5	AFDB:Q96SZ4	0.314	0.353	4.480E-41	725	0.287	0.332	Q96SZ4.pdb.gz	ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZSCAN10 PE=1 SV=1
6	AFDB:P52742	0.171	0.214	5.261E-41	658	0.266	0.339	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
7	AFDB:A8K8Y5	0.202	0.230	3.077E-40	707	0.267	0.317	A8K8Y5.pdb.gz	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
8	AFDB:Q9Y2P7	0.261	0.332	4.982E-40	627	0.256	0.343	Q9Y2P7.pdb.gz	ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens OX=9606 GN=ZNF256 PE=1 SV=2
9	AFDB:Q9UJW7	0.186	0.189	7.645E-40	825	0.282	0.287	Q9UJW7.pdb.gz	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4
10	AFDB:O75290	0.186	0.233	9.991E-40	641	0.272	0.356	O75290.pdb.gz	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
11	PDB:3w5kB	0.064	0.274	6.471E-4	110	0.049	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dkaA	0.032	0.171	1.365	96	0.018	0.156	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:7o4iW	0.036	0.074	1.986	312	0.031	0.083	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:3javA	0.059	0.033	2.460	2327	0.116	0.042	3javA.pdb.gz
15	PDB:7ad8D	0.040	0.081	2.596	280	0.038	0.114	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
16	PDB:7qo48	0.049	0.086	2.889	372	0.014	0.032	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
17	PDB:7pmkQ	0.030	0.033	3.048	766	0.020	0.022	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
18	PDB:7oqyY	0.026	0.153	3.392	92	0.023	0.207	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
19	PDB:6kopF	0.037	0.139	4.433	159	0.031	0.164	6kopF.pdb.gz	RNA extension drives a stepwise displacement of an initiation-factor structural module in initial transcription.
20	PDB:3kloA	0.048	0.135	6.448	217	0.021	0.083	3kloA.pdb.gz	Vibrio cholerae VpsT Regulates Matrix Production and Motility by Directly Sensing Cyclic di-GMP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2L8	0.0	1738	839	1.000	1.000	ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens OX=9606 GN=ZKSCAN5 PE=1 SV=1
2	Q9P0L1	5.88e-149	457	754	0.360	0.401	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
3	Q8TAQ5	1.04e-138	429	688	0.303	0.369	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
4	O43309	2.61e-135	417	611	0.312	0.429	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
5	Q15776	1.46e-134	414	578	0.323	0.469	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
6	Q8IYB9	4.03e-132	410	648	0.281	0.364	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
7	P51523	1.29e-128	404	738	0.257	0.293	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
8	Q7TMN8	1.22e-127	396	578	0.263	0.382	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
9	Q8BLA2	3.04e-127	395	578	0.267	0.388	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
10	O75290	8.78e-127	396	641	0.274	0.359	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
11	P52742	3.44e-125	393	658	0.286	0.365	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
12	Q6ECI4	7.65e-125	394	717	0.251	0.294	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
13	A6NNF4	1.94e-123	387	616	0.278	0.378	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
14	Q9EQB9	6.27e-123	390	759	0.315	0.348	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
15	Q9P2J8	4.86e-122	390	865	0.262	0.254	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
16	Q9NZL3	6.94e-122	385	707	0.285	0.338	ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens OX=9606 GN=ZNF224 PE=1 SV=3
17	A8K8Y5	1.53e-121	385	707	0.284	0.337	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
18	Q9UJW7	6.60e-121	387	825	0.265	0.269	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4
19	Q96JF6	8.72e-121	385	807	0.249	0.259	ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens OX=9606 GN=ZNF594 PE=2 SV=3
20	Q05481	1.66e-120	394	1191	0.257	0.181	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10403 BHD_1	46	15.4	Rad4 beta-hairpin domain 1
2	PF01352 KRAB	1e-09	49.1	KRAB box
3	PF02023 SCAN	5e-37	136.9	SCAN domain
4	PF00096 zf-C2H2	2e-49	174.5	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	44	15.3	zinc-finger C2H2-type
6	PF13894 zf-C2H2_4	2.8e-20	82.2	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	0.074	24.3	C2H2-type zinc finger
8	PF15909 zf-C2H2_8	0.9	21.3	C2H2-type zinc ribbon
9	PF12171 zf-C2H2_jaz	29	16.3	Zinc-finger double-stranded RNA-binding
10	PF13465 zf-H2C2_2	2e-61	213.1	Zinc-finger double domain
11	PF17032 zinc_ribbon_15	4.8	19.4	zinc-ribbon family
12	PF09723 Zn-ribbon_8	0.0083	27.6	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377725

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265097	0.678	THO complex subunit 3
2	9606.ENSP00000355053	0.636	Zinc finger and SCAN domain-containing protein 20
3	9606.ENSP00000420306	0.626	THO complex subunit 5 homolog
4	9606.ENSP00000272647	0.608	AMMECR1-like protein
5	9606.ENSP00000354645	0.592	G patch domain-containing protein 3
6	9606.ENSP00000347626	0.575	NudC domain containing 3
7	9606.ENSP00000262942	0.569	Actin-related protein 2/3 complex subunit 1A
8	9606.ENSP00000360642	0.563	Coiled-coil and C2 domain-containing protein 1B
9	9606.ENSP00000247194	0.561	Trans-3-hydroxy-L-proline dehydratase
10	9606.ENSP00000382508	0.561	Cell death-inducing p53-target protein 1
11	9606.ENSP00000411372	0.556	Protein FAM200A
12	9606.ENSP00000352941	0.548	BTB/POZ domain-containing protein KCTD18
13	9606.ENSP00000485378	0.541	Ribonuclease P protein subunit p21
14	9606.ENSP00000256257	0.536	RING finger protein 122
15	9606.ENSP00000362105	0.535	Probable U3 small nucleolar RNA-associated protein 11
16	9606.ENSP00000251768	0.531	Electrogenic sodium bicarbonate cotransporter 4
17	9606.ENSP00000257181	0.531	Pre-mRNA-splicing factor 38A
18	9606.ENSP00000344393	0.529	rRNA-processing protein FCF1 homolog
19	9606.ENSP00000428223	0.527	Ribosomal protein L26 like 1
20	9606.ENSP00000481091	0.526	Transcriptional adapter 2-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.485	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0019222	0.898	regulation of metabolic process
GO:0051171	0.877	regulation of nitrogen compound metabolic process
GO:0080090	0.873	regulation of primary metabolic process
GO:0031323	0.873	regulation of cellular metabolic process
GO:0060255	0.871	regulation of macromolecule metabolic process
GO:0010468	0.783	regulation of gene expression
GO:0009987	0.778	cellular process
GO:0051252	0.764	regulation of RNA metabolic process
GO:0010556	0.762	regulation of macromolecule biosynthetic process
GO:0031326	0.762	regulation of cellular biosynthetic process
GO:0006355	0.716	regulation of DNA-templated transcription
GO:0048519	0.515	negative regulation of biological process
GO:0048523	0.438	negative regulation of cellular process
GO:0048518	0.339	positive regulation of biological process
GO:0048522	0.304	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.989	nucleoplasm
GO:0005737	0.723	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]