StarFunc result for job id Q9Y2L9

User Input

>input (728 residues)
MATPGSEPQPFVPALSVATLHPLHHPHHHHHHHQHHGGTGAPGGAGGGGGGSGGFNLPLN
RGLERALEEAANSGGLNLSARKLKEFPRTAAPGHDLSDTVQADLSKNRLVEVPMELCHFV
SLEILNLYHNCIRVIPEAIVNLQMLTYLNLSRNQLSALPACLCGLPLKVLIASNNKLGSL
PEEIGQLKQLMELDVSCNEITALPQQIGQLKSLRELNVRRNYLKVLPQELVDLSLVKFDF
SCNKVLVIPICFREMKQLQVLLLENNPLQSPPAQICTKGKVHIFKYLSIQACQIKTADSL
YLHTMERPHLHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIMEEEQI
IKEDSCHRLSPVKGEFHQEFQPEPSLLGDSTNSGEERDQFTDRADGLHSEFMNYKARAED
CEELLRIEEDVHWQTEGIISSSKDQDMDIAMIEQLREAVDLLQDPNGLSTDITERSVLNL
YPMGSAEALELQDSALNGQIQLETSPVCEVQSDLTLQSNGSQYSPNEIRENSPAVSPTTN
STAPFGLKPRSVFLRPQRNLESIDPQFTIRRKMEQMREEKELVEQLRESIEMRLKVSLHE
DLGAALMDGVVLCHLVNHIRPRSVASIHVPSPAVPKLSMAKCRRNVENFLEACRKLGVPE
ADLCSPCDILQLDFRHIRKTVDTLLALGEKAPPPTSALRSRDLIGFCLVHILFIVLVYIT
YHWNALSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2L9	1.000	1.000	1.151E-101	728	1.000	1.000	Q9Y2L9.pdb.gz	LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRCH1 PE=1 SV=3
2	AFDB:Q96II8	0.329	0.308	1.510E-46	777	0.442	0.414	Q96II8.pdb.gz	LRCH3_HUMAN DISP complex protein LRCH3 OS=Homo sapiens OX=9606 GN=LRCH3 PE=1 SV=2
3	AFDB:Q9VJE6	0.328	0.212	1.244E-38	1135	0.360	0.231	Q9VJE6.pdb.gz	Q9VJE6_DROME Leucine-rich-repeats and calponin homology domain protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Lrch PE=1 SV=1
4	AFDB:Q96RT1	0.222	0.118	7.843E-13	1412	0.141	0.073	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
5	AFDB:H7C1G3	0.171	0.545	4.041E-12	214	0.137	0.467	H7C1G3.pdb.gz	H7C1G3_HUMAN Leucine rich repeats and calponin homology domain containing 3 (Fragment) OS=Homo sapiens OX=9606 GN=LRCH3 PE=1 SV=1
6	PDB:7lt9A	0.303	0.847	4.672E-12	251	0.113	0.327	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
7	PDB:7tvfD	0.241	0.333	2.294E-11	515	0.089	0.126	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
8	AFDB:Q9T0K5	0.210	0.202	9.977E-9	760	0.128	0.122	Q9T0K5.pdb.gz	LRX3_ARATH Leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=LRX3 PE=1 SV=1
9	PDB:7p5vB	0.269	0.267	2.057E-8	732	0.069	0.068	7p5vB.pdb.gz
10	PDB:6hkwA	0.252	0.580	1.285E-7	306	0.070	0.167	6hkwA.pdb.gz
11	PDB:7ploO	0.189	0.354	4.089E-7	382	0.077	0.147	7ploO.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
12	PDB:5yq5B	0.227	0.520	6.950E-7	306	0.070	0.167	5yq5B.pdb.gz
13	PDB:1xcdA	0.228	0.523	9.282E-7	305	0.060	0.144	1xcdA.pdb.gz
14	PDB:5xjxC	0.231	0.444	1.240E-6	365	0.077	0.153	5xjxC.pdb.gz
15	AFDB:Q7ZV84	0.200	0.256	1.365E-6	555	0.114	0.150	Q7ZV84.pdb.gz	DAAF1_DANRE Dynein axonemal assembly factor 1 OS=Danio rerio OX=7955 GN=dnaaf1 PE=2 SV=2
16	AFDB:O35930	0.225	0.223	2.106E-6	734	0.136	0.135	O35930.pdb.gz	GP1BA_MOUSE Platelet glycoprotein Ib alpha chain OS=Mus musculus OX=10090 GN=Gp1ba PE=1 SV=2
17	PDB:6zxdk	0.218	0.349	3.581E-6	430	0.082	0.140	6zxdk.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
18	PDB:6gffI	0.193	0.244	7.746E-6	551	0.074	0.098	6gffI.pdb.gz
19	AFDB:Q80TM9	0.197	0.096	9.390E-6	1593	0.109	0.050	Q80TM9.pdb.gz	NISCH_MOUSE Nischarin OS=Mus musculus OX=10090 GN=Nisch PE=1 SV=2
20	AFDB:Q8INT5	0.227	0.117	3.290E-5	1483	0.181	0.089	Q8INT5.pdb.gz	DAAF1_DROME Dynein axonemal assembly factor 1 homolog OS=Drosophila melanogaster OX=7227 GN=dtr PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62046	0.0	1092	709	0.775	0.795	LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lrch1 PE=1 SV=2
2	Q5VUJ6	0.0	537	765	0.446	0.425	LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LRCH2 PE=1 SV=2
3	Q9Y2L9	0.0	1493	728	1.000	1.000	LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRCH1 PE=1 SV=3
4	Q96II8	7.22e-115	366	777	0.265	0.248	LRCH3_HUMAN DISP complex protein LRCH3 OS=Homo sapiens OX=9606 GN=LRCH3 PE=1 SV=2
5	O75427	6.18e-92	303	683	0.243	0.259	LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRCH4 PE=1 SV=2
6	Q921G6	1.44e-88	294	680	0.220	0.235	LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus OX=10090 GN=Lrch4 PE=1 SV=1
7	Q960C5	3.16e-63	228	809	0.185	0.167	LRCH_DROME Leucine-rich repeat and calponin homology domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Lrch PE=2 SV=1
8	X2JA56	5.60e-62	227	1079	0.185	0.125	X2JA56_DROME Leucine-rich-repeats and calponin homology domain protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Lrch PE=1 SV=1
9	Q9VJE6	6.41e-62	227	1135	0.185	0.119	Q9VJE6_DROME Leucine-rich-repeats and calponin homology domain protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Lrch PE=1 SV=1
10	H7C0J8	4.52e-45	163	227	0.107	0.344	H7C0J8_HUMAN Leucine rich repeats and calponin homology domain containing 3 (Fragment) OS=Homo sapiens OX=9606 GN=LRCH3 PE=1 SV=1
11	H7C1G3	5.70e-43	156	214	0.124	0.421	H7C1G3_HUMAN Leucine rich repeats and calponin homology domain containing 3 (Fragment) OS=Homo sapiens OX=9606 GN=LRCH3 PE=1 SV=1
12	E9PD99	1.31e-39	157	623	0.124	0.144	E9PD99_HUMAN Leucine rich repeats and calponin homology domain containing 3 OS=Homo sapiens OX=9606 GN=LRCH3 PE=1 SV=1
13	Q6Z8P4	4.05e-24	109	576	0.124	0.156	PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica OX=39947 GN=IRL4 PE=2 SV=1
14	Q8S7M7	2.04e-23	107	543	0.103	0.138	PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica OX=39947 GN=IRL5 PE=2 SV=1
15	Q15404	8.72e-23	101	277	0.109	0.285	RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens OX=9606 GN=RSU1 PE=1 SV=3
16	Q8W4Q3	5.14e-22	102	464	0.099	0.155	PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana OX=3702 GN=PIRL3 PE=2 SV=1
17	Q01730	4.60e-21	96.3	277	0.107	0.282	RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus OX=10090 GN=Rsu1 PE=1 SV=3
18	Q9LRV8	8.21e-21	98.6	471	0.096	0.149	PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana OX=3702 GN=PIRL2 PE=2 SV=1
19	B0M0P8	1.93e-20	99.8	2356	0.098	0.030	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1
20	Q9FFJ3	9.93e-20	95.5	506	0.098	0.140	PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana OX=3702 GN=PIRL1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	1.9	19.7	CAMSAP CH domain
2	PF00307 CH	4.2e-08	44.7	Calponin homology (CH) domain
3	PF00560 LRR_1	0.3	22.6	Leucine Rich Repeat
4	PF12799 LRR_4	1.6e-10	52.2	Leucine Rich repeats (2 copies)
5	PF13516 LRR_6	23	16.5	Leucine Rich repeat
6	PF13855 LRR_8	1e-19	81.4	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374447

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000394888	0.925	Dedicator of cytokinesis protein 8
2	9606.ENSP00000251157	0.753	Dedicator of cytokinesis protein 7
3	9606.ENSP00000414786	0.718	Transmembrane protein 64
4	9606.ENSP00000372459	0.714	CBP80/20-dependent translation initiation factor
5	9606.ENSP00000334375	0.697	Leucine rich repeats and calponin homology domain containing 3
6	9606.ENSP00000328998	0.694	Trafficking kinesin-binding protein 1
7	9606.ENSP00000377280	0.680	F-box only protein 8
8	9606.ENSP00000330433	0.646	TM2 domain containing 3
9	9606.ENSP00000243347	0.645	Tumor necrosis factor-inducible gene 6 protein
10	9606.ENSP00000199447	0.640	Thioredoxin domain-containing protein 3
11	9606.ENSP00000318177	0.639	Far upstream element-binding protein 3
12	9606.ENSP00000294618	0.636	Dedicator of cytokinesis protein 6
13	9606.ENSP00000339067	0.636	Fibroblast growth factor-binding protein 3
14	9606.ENSP00000284268	0.609	Progressive ankylosis protein homolog
15	9606.ENSP00000363553	0.609	Lysophosphatidic acid receptor 1
16	9606.ENSP00000334044	0.563	Ubiquitin-like protein 4B
17	9606.ENSP00000297866	0.536	Cilia- and flagella-associated protein 47
18	9606.ENSP00000367926	0.536	Cilia- and flagella-associated protein 47
19	9606.ENSP00000367929	0.536	Cilia- and flagella-associated protein 47
20	9606.ENSP00000325836	0.521	GTP-binding protein Di-Ras1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0050896	0.945	response to stimulus
GO:0051716	0.924	cellular response to stimulus
GO:0065009	0.914	regulation of molecular function
GO:0030334	0.912	regulation of cell migration
GO:1990868	0.888	response to chemokine
GO:0002685	0.885	regulation of leukocyte migration
GO:0050790	0.878	regulation of catalytic activity
GO:2000401	0.876	regulation of lymphocyte migration
GO:0002683	0.872	negative regulation of immune system process
GO:0051336	0.868	regulation of hydrolase activity
GO:0048523	0.854	negative regulation of cellular process
GO:0043086	0.837	negative regulation of catalytic activity
GO:0043087	0.822	regulation of GTPase activity
GO:0070887	0.781	cellular response to chemical stimulus
GO:0071310	0.718	cellular response to organic substance
GO:2000404	0.697	regulation of T cell migration
GO:0040013	0.682	negative regulation of locomotion
GO:0071345	0.669	cellular response to cytokine stimulus
GO:0034260	0.664	negative regulation of GTPase activity
GO:1990869	0.547	cellular response to chemokine
GO:0030336	0.534	negative regulation of cell migration
GO:0002686	0.358	negative regulation of leukocyte migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043226	0.907	organelle
GO:0043229	0.879	intracellular organelle
GO:0043231	0.783	intracellular membrane-bounded organelle
GO:0070013	0.526	intracellular organelle lumen
GO:0016020	0.497	membrane
GO:0005654	0.418	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]