StarFunc result for job id Q9Y2M0

User Input

>input (1017 residues)
MMSEGKPPDKKRPRRSLSISKNKKKASNSIISCFNNAPPAKLACPVCSKMVPRYDLNRHL
DEMCANNDFVQVDPGQVGLINSNVSMVDLTSVTLEDVTPKKSPPPKTNLTPGQSDSAKRE
VKQKISPYFKSNDVVCKNQDELRNRSVKVICLGSLASKLSRKYVKAKKSIDKDEEFAGSS
PQSSKSTVVKSLIDNSSEIEDEDQILENSSQKENVFKCDSLKEECIPEHMVRGSKIMEAE
SQKATRECEKSALTPGFSDNAIMLFSPDFTLRNTLKSTSEDSLVKQECIKEVVEKREACH
CEEVKMTVASEAKIQLSDSEAKSHSSADDASAWSNIQEAPLQDDSCLNNDIPHSIPLEQG
SSCNGPGQTTGHPYYLRSFLVVLKTVLENEDDMLLFDEQEKGIVTKFYQLSATGQKLYVR
LFQRKLSWIKMTKLEYEEIALDLTPVIEELTNAGFLQTESELQELSEVLELLSAPELKSL
AKTFHLVNPNGQKQQLVDAFLKLAKQRSVCTWGKNKPGIGAVILKRAKALAGQSVRICKG
PRAVFSRILLLFSLTDSMEDEDAACGGQGQLSTVLLVNLGRMEFPSYTINRKTHIFQDRD
DLIRYAAATHMLSDISSAMANGNWEEAKELAQCAKRDWNRLKNHPSLRCHEDLPLFLRCF
TVGWIYTRILSRFVEILQRLHMYEEAVRELESLLSQRIYCPDSRGRWWDRLALNLHQHLK
RLEPTIKCITEGLADPEVRTGHRLSLYQRAVRLRESPSCKKFKHLFQQLPEMAVQDVKHV
TITGRLCPQRGMCKSVFVMEAGEAADPTTVLCSVEELALAHYRRSGFDQGIHGEGSTFST
LYGLLLWDIIFMDGIPDVFRNACQAFPLDLCTDSFFTSRRPALEARLQLIHDAPEESLRA
WVAATWHEQEGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPD
LVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVVAVGAKSQSLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q69ZT1	0.694	0.692	0.000	1020	0.719	0.717	Q69ZT1.pdb.gz	FAN1_MOUSE Fanconi-associated nuclease 1 OS=Mus musculus OX=10090 GN=Fan1 PE=2 SV=2
2	AFDB:Q9Y2M0	1.000	1.000	0.000	1017	1.000	1.000	Q9Y2M0.pdb.gz	FAN1_HUMAN Fanconi-associated nuclease 1 OS=Homo sapiens OX=9606 GN=FAN1 PE=1 SV=4
3	PDB:5y7qA	0.448	0.791	9.939E-22	546	0.136	0.253	5y7qA.pdb.gz	Structural mechanism of DNA interstrand cross-link unhooking by the bacterial FAN1 nuclease.
4	AFDB:Q68CQ1	0.079	0.065	1.310E-3	1323	0.146	0.112	Q68CQ1.pdb.gz	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
5	AFDB:A0A0R4IZ84	0.117	0.084	3.718E-3	1544	0.135	0.089	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
6	AFDB:G5E870	0.113	0.070	4.826E-3	2025	0.128	0.064	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
7	AFDB:Q99569	0.069	0.064	7.786E-3	1192	0.115	0.098	Q99569.pdb.gz	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
8	PDB:3n71A	0.112	0.224	9.834E-3	468	0.029	0.062	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
9	AFDB:Q14669	0.115	0.073	1.056E-2	1992	0.134	0.068	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
10	AFDB:Q9Y4F4	0.085	0.057	1.056E-2	1720	0.116	0.069	Q9Y4F4.pdb.gz	TGRM1_HUMAN TOG array regulator of axonemal microtubules protein 1 OS=Homo sapiens OX=9606 GN=TOGARAM1 PE=1 SV=4
11	AFDB:Q24367	0.102	0.114	1.151E-2	859	0.105	0.125	Q24367.pdb.gz	Q24367_DROME Inscuteable OS=Drosophila melanogaster OX=7227 GN=insc PE=1 SV=1
12	PDB:7kzpG	0.110	0.169	1.170E-2	577	0.056	0.099	7kzpG.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
13	PDB:2fi7A	0.118	0.438	1.731E-2	223	0.029	0.135	2fi7A.pdb.gz
14	AFDB:Q8IN05	0.098	0.081	1.778E-2	1415	0.126	0.090	Q8IN05.pdb.gz	Q8IN05_DROME Liquid facets-Related, isoform D OS=Drosophila melanogaster OX=7227 GN=lqfR PE=1 SV=2
15	PDB:6bq1B	0.115	0.150	2.559E-2	728	0.065	0.091	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
16	PDB:6xt9D	0.103	0.212	3.046E-2	396	0.058	0.149	6xt9D.pdb.gz
17	PDB:4i9eA	0.138	0.308	3.322E-2	383	0.060	0.159	4i9eA.pdb.gz	Structural basis of Rap phosphatase inhibition by Phr peptides
18	PDB:7nj1A	0.100	0.079	4.129E-2	1448	0.097	0.068	7nj1A.pdb.gz
19	PDB:6n3qF	0.109	0.509	4.313E-2	190	0.029	0.153	6n3qF.pdb.gz
20	PDB:6ww7B	0.122	0.369	4.504E-2	281	0.039	0.142	6ww7B.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A590UKC0	0.0	1225	587	0.577	1.000	A0A590UKC0_HUMAN Fanconi-associated nuclease OS=Homo sapiens OX=9606 GN=FAN1 PE=1 SV=1
2	Q69ZT1	0.0	1449	1020	0.723	0.721	FAN1_MOUSE Fanconi-associated nuclease 1 OS=Mus musculus OX=10090 GN=Fan1 PE=2 SV=2
3	Q9Y2M0	0.0	2109	1017	1.000	1.000	FAN1_HUMAN Fanconi-associated nuclease 1 OS=Homo sapiens OX=9606 GN=FAN1 PE=1 SV=4
4	Q5XVJ4	7.56e-76	270	891	0.195	0.222	FAN1_ARATH Fanconi-associated nuclease 1 homolog OS=Arabidopsis thaliana OX=3702 GN=FAN1 PE=2 SV=2
5	P90740	3.21e-73	262	865	0.211	0.249	FAN1_CAEEL Fanconi-associated nuclease 1 homolog OS=Caenorhabditis elegans OX=6239 GN=fan-1 PE=1 SV=1
6	Q9Y804	1.26e-54	205	703	0.180	0.260	FAN1_SCHPO Fanconi-associated nuclease 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC146.06c PE=1 SV=1
7	Q9I2N0	1.54e-14	80.1	559	0.061	0.111	FAN1_PSEAE Fanconi-associated nuclease 1 homolog OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=fan1 PE=1 SV=1
8	Q38AL0	0.016	41.6	982	0.024	0.024	Q38AL0_TRYB2 Fanconi-associated nuclease OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3110 PE=3 SV=1
9	D3ZPQ3	1.5	34.7	282	0.022	0.078	D3ZPQ3_RAT XIAP associated factor 1 OS=Rattus norvegicus OX=10116 GN=Xaf1 PE=1 SV=4
10	A0A8I5ZLW0	3.4	33.5	284	0.022	0.077	A0A8I5ZLW0_RAT XIAP associated factor 1 OS=Rattus norvegicus OX=10116 GN=Xaf1 PE=1 SV=1
11	Q6FQ06	4.7	33.5	906	0.027	0.030	Q6FQ06_CANGA Candida glabrata strain CBS138 chromosome I complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=NDC10 PE=4 SV=1
12	Q17391	6.7	33.1	777	0.037	0.049	CUL3_CAEEL Cullin-3 OS=Caenorhabditis elegans OX=6239 GN=cul-3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14276 DUF4363	49	15.4	Domain of unknown function (DUF4363)
2	PF13424 TPR_12	2e+02	13.7	Tetratricopeptide repeat
3	PF13428 TPR_14	4.7e+02	13.1	Tetratricopeptide repeat
4	PF08774 VRR_NUC	1.9e-30	116.6	VRR-NUC domain
5	PF02176 zf-TRAF	98	15.1	TRAF-type zinc finger
6	PF18279 zf-WRNIP1_ubi	1.4e+02	14.5	Werner helicase-interacting protein 1 ubiquitin-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354497

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287647	0.999	Fanconi anemia group D2 protein
2	9606.ENSP00000231790	0.992	DNA mismatch repair protein Mlh1
3	9606.ENSP00000310842	0.989	Fanconi anemia group I protein
4	9606.ENSP00000265849	0.974	Mismatch repair endonuclease PMS2
5	9606.ENSP00000343526	0.943	Ubiquitin carboxyl-terminal hydrolase 1
6	9606.ENSP00000267430	0.937	Fanconi anemia group M protein
7	9606.ENSP00000307491	0.934	WD repeat-containing protein 48
8	9606.ENSP00000307853	0.926	Crossover junction endonuclease MUS81
9	9606.ENSP00000406490	0.916	PMS1 protein homolog 1
10	9606.ENSP00000355185	0.880	DNA cross-link repair 1A protein
11	9606.ENSP00000385021	0.866	E3 ubiquitin-protein ligase FANCL
12	9606.ENSP00000466121	0.856	Fanconi anemia core complex-associated protein 24
13	9606.ENSP00000310520	0.852	DNA repair endonuclease XPF
14	9606.ENSP00000294008	0.850	Structure-specific endonuclease subunit SLX4
15	9606.ENSP00000358576	0.843	5' exonuclease Apollo
16	9606.ENSP00000013807	0.841	DNA excision repair protein ERCC-1
17	9606.ENSP00000367910	0.835	Fanconi anemia group G protein
18	9606.ENSP00000402537	0.819	Myotubularin-related protein 10
19	9606.ENSP00000435506	0.809	DNA polymerase nu
20	9606.ENSP00000229769	0.807	Fanconi anemia group E protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140035	1.000	ubiquitination-like modification-dependent protein binding
GO:0003677	1.000	DNA binding
GO:0000287	1.000	magnesium ion binding
GO:0008409	1.000	5'-3' exonuclease activity
GO:0017108	1.000	5'-flap endonuclease activity
GO:0070336	0.982	flap-structured DNA binding
GO:0140036	0.904	ubiquitin-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.997	organic substance metabolic process
GO:0050896	0.996	response to stimulus
GO:0044238	0.996	primary metabolic process
GO:0006302	0.992	double-strand break repair
GO:0036297	0.969	interstrand cross-link repair
GO:0006289	0.964	nucleotide-excision repair
GO:0006310	0.960	DNA recombination
GO:0000725	0.943	recombinational repair
GO:0000724	0.929	double-strand break repair via homologous recombination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0045171	0.995	intercellular bridge
GO:0043232	0.951	intracellular non-membrane-bounded organelle
GO:0032991	0.588	protein-containing complex
GO:0016020	0.469	membrane
GO:0005694	0.320	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.21.-	1.000	Endodeoxyribonucleases producing 5'-phosphomonoesters.

[back to server]