StarFunc result for job id Q9Y2Q0

User Input

>input (1164 residues)
MPTMRRTVSEIRSRAEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVSTAKYN
IITFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIED
IKRHKADNAVNKKQTQVLRNGAWEIVHWEKVAVGEIVKVTNGEHLPADLISLSSSEPQAM
CYIETSNLDGETNLKIRQGLPATSDIKDVDSLMRISGRIECESPNRHLYDFVGNIRLDGH
GTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTSPPLKLSNVERITNVQILI
LFCILIAMSLVCSVGSAIWNRRHSGKDWYLNLNYGGASNFGLNFLTFIILFNNLIPISLL
VTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQ
FKKCTIAGVAYGHVPEPEDYGCSPDEWQNSQFGDEKTFSDSSLLENLQNNHPTAPIICEF
LTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEER
YELLNVLEFTSARKRMSVIVRTPSGKLRLYCKGADTVIYDRLAETSKYKEITLKHLEQFA
TEGLRTLCFAVAEISESDFQEWRAVYQRASTSVQNRLLKLEESYELIEKNLQLLGATAIE
DKLQDQVPETIETLMKADIKIWILTGDKQETAINIGHSCKLLKKNMGMIVINEGSLDGTR
ETLSRHCTTLGDALRKENDFALIIDGKTLKYALTFGVRQYFLDLALSCKAVICCRVSPLQ
KSEVVEMVKKQVKVVTLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYL
KNLLMIHGAWNYNRVSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMF
TAMPPLTLGIFERSCRKENMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPL
KALQYGTAFGNGKTSDYLLLGNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVV
FFGIYSSLWPAIPMAPDMSGEAAMLFSSGVFWMGLLFIPVASLLLDVVYKVIKRTAFKTL
VDEVQELEAKSQDPGAVVLGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQD
ENGIVSQSEVIRAYDTTKQRPDEW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6k7lA	0.821	0.960	0.000	992	0.837	0.982	6k7lA.pdb.gz	Cryo-EM structures capture the transport cycle of the P4-ATPase flippase.
2	AFDB:O94296	0.898	0.833	0.000	1258	0.454	0.421	O94296.pdb.gz	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1
3	AFDB:P39524	0.893	0.770	0.000	1355	0.450	0.387	P39524.pdb.gz	ATC3_YEAST Phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DRS2 PE=1 SV=2
4	AFDB:P70704	0.971	0.971	0.000	1164	0.981	0.981	P70704.pdb.gz	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
5	AFDB:Q9NTI2	0.944	0.925	0.000	1188	0.672	0.658	Q9NTI2.pdb.gz	AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens OX=9606 GN=ATP8A2 PE=1 SV=3
6	AFDB:Q9U280	0.906	0.925	0.000	1139	0.465	0.475	Q9U280.pdb.gz	TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans OX=6239 GN=tat-1 PE=1 SV=3
7	AFDB:Q7YXV5	0.897	0.824	1.341E-102	1270	0.393	0.360	Q7YXV5.pdb.gz	Q7YXV5_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-2 PE=1 SV=2
8	AFDB:P98198	0.881	0.849	2.937E-102	1209	0.402	0.387	P98198.pdb.gz	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2
9	AFDB:Q8TF62	0.878	0.858	6.434E-102	1192	0.396	0.387	Q8TF62.pdb.gz	AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens OX=9606 GN=ATP8B4 PE=1 SV=3
10	AFDB:Q9XIE6	0.863	0.829	1.764E-100	1213	0.401	0.385	Q9XIE6.pdb.gz	ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana OX=3702 GN=ALA3 PE=1 SV=2
11	AFDB:D4AA47	0.870	0.811	3.413E-99	1251	0.407	0.379	D4AA47.pdb.gz	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
12	PDB:6rohA	0.866	0.905	8.732E-98	1112	0.446	0.467	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
13	PDB:7py4A	0.822	0.859	8.180E-88	1112	0.386	0.404	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
14	PDB:7kycA	0.855	0.845	1.132E-84	1178	0.357	0.352	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
15	PDB:7vghB	0.830	0.818	2.479E-84	1183	0.387	0.381	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
16	PDB:7kyaA	0.849	0.842	8.620E-80	1174	0.348	0.345	7kyaA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
17	PDB:7bspA	0.676	0.755	1.216E-73	1028	0.326	0.370	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
18	PDB:6lknA	0.779	0.849	1.654E-66	1064	0.333	0.365	6lknA.pdb.gz	Crystal structure of a human plasma membrane phospholipid flippase.
19	PDB:7rd6A	0.730	0.906	7.371E-64	929	0.258	0.323	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
20	PDB:7bssA	0.593	0.823	1.022E-53	816	0.255	0.364	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PJN3	595	1479	0.302	0.238	A0A1D8PJN3_CANAL Phospholipid-transporting ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DNF1 PE=3 SV=1
2	A0A5K1VW70	863	1190	0.393	0.384	A0A5K1VW70_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=1
3	A0A8I5ZKC1	1986	985	0.818	0.966	A0A8I5ZKC1_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
4	A0A8I5ZXX6	2389	1164	0.979	0.979	A0A8I5ZXX6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
5	A0A8I6AVY6	2363	1164	0.969	0.969	A0A8I6AVY6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
6	A0A8I6G2I8	1986	978	0.818	0.973	A0A8I6G2I8_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
7	A3FIN4	815	1183	0.381	0.374	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
8	C7EXK4	1642	1148	0.669	0.679	AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus OX=9913 GN=ATP8A2 PE=1 SV=4
9	D4A3X6	1575	1169	0.644	0.642	D4A3X6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a2 PE=1 SV=3
10	D4AA47	597	1251	0.271	0.252	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
11	E9PEJ6	692	1191	0.358	0.350	E9PEJ6_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
12	F1LUT4	1987	984	0.819	0.968	F1LUT4_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=4
13	F4IE35	800	1185	0.407	0.400	F4IE35_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g26130 PE=1 SV=1
14	F4K8T6	612	1139	0.327	0.335	F4K8T6_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=ALA2 PE=1 SV=1
15	H0Y547	615	935	0.311	0.387	H0Y547_HUMAN Phospholipid-transporting ATPase (Fragment) OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
16	O36028	612	1367	0.319	0.271	ATCZ_SCHPO Phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F10.16c PE=3 SV=1
17	O43520	590	1251	0.264	0.245	AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens OX=9606 GN=ATP8B1 PE=1 SV=3
18	O94296	1023	1258	0.456	0.422	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1
19	P32660	644	1571	0.331	0.245	ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DNF1 PE=1 SV=2
20	P39524	1014	1355	0.455	0.391	ATC3_YEAST Phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DRS2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	4.4e-10	50.8	Cation transport ATPase (P-type)
2	PF00122 E1-E2_ATPase	2.7e-05	35.3	E1-E2 ATPase
3	PF00702 Hydrolase	2.3e-07	42.8	haloacid dehalogenase-like hydrolase
4	PF08282 Hydrolase_3	0.48	21.7	haloacid dehalogenase-like hydrolase
5	PF16212 PhoLip_ATPase_C	2.2e-80	281.6	Phospholipid-translocating P-type ATPase C-terminal
6	PF16209 PhoLip_ATPase_N	1.9e-22	90.0	Phospholipid-translocating ATPase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371084

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230461	0.998	Cell cycle control protein 50A
2	9606.ENSP00000382670	0.922	Glutaredoxin domain-containing cysteine-rich protein 1
3	9606.ENSP00000450842	0.785	Cell cycle control protein 50B
4	9606.ENSP00000419663	0.754	Cell cycle control protein 50C
5	9606.ENSP00000419923	0.731	Krueppel-like factor 6
6	9606.ENSP00000286371	0.627	Sodium/potassium-transporting ATPase subunit beta-3
7	9606.ENSP00000452780	0.555	Beta-2-microglobulin
8	9606.ENSP00000352208	0.553	Myoferlin
9	9606.ENSP00000352603	0.553	AP-4 complex subunit mu-1
10	9606.ENSP00000415556	0.551	DDB1- and CUL4-associated factor 11
11	9606.ENSP00000218008	0.547	Protein ATP1B4
12	9606.ENSP00000298248	0.544	Lambda-crystallin homolog
13	9606.ENSP00000398523	0.544	Calcium-binding and coiled-coil domain-containing protein 2
14	9606.ENSP00000479153	0.544	EH domain-containing protein 1
15	9606.ENSP00000296161	0.543	E3 ubiquitin-protein ligase DTX3L
16	9606.ENSP00000462729	0.543	OTU domain-containing protein 7B
17	9606.ENSP00000299886	0.542	Conserved oligomeric Golgi complex subunit 1
18	9606.ENSP00000263918	0.536	Striatin
19	9606.ENSP00000298832	0.535	Tubulin polyglutamylase TTLL5
20	9606.ENSP00000370737	0.521	Glycine dehydrogenase (decarboxylating), mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140333	0.998	glycerophospholipid flippase activity
GO:0015247	0.626	aminophospholipid flippase activity
GO:0140346	0.426	phosphatidylserine flippase activity
GO:0008525	0.343	phosphatidylcholine transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.997	biological regulation
GO:0061024	0.985	membrane organization
GO:0097035	0.983	regulation of membrane lipid distribution
GO:0051179	0.979	localization
GO:0015914	0.958	phospholipid transport
GO:0034204	0.920	lipid translocation
GO:0045332	0.811	phospholipid translocation
GO:0050789	0.805	regulation of biological process
GO:0050794	0.785	regulation of cellular process
GO:0048518	0.372	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031982	0.994	vesicle
GO:0031090	0.975	organelle membrane
GO:0098588	0.962	bounding membrane of organelle
GO:0031410	0.948	cytoplasmic vesicle
GO:0030659	0.913	cytoplasmic vesicle membrane
GO:0099503	0.706	secretory vesicle
GO:0030672	0.666	synaptic vesicle membrane
GO:0005886	0.501	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	1.000	P-type phospholipid transporter.

[back to server]