StarFunc result for job id Q9Y2Q5

User Input

>input (125 residues)
MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNG
NQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLT
QVAAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JHS3	0.994	0.994	2.941E-24	125	0.992	0.992	Q9JHS3.pdb.gz	LTOR2_MOUSE Ragulator complex protein LAMTOR2 OS=Mus musculus OX=10090 GN=Lamtor2 PE=1 SV=1
2	PDB:6b9xB	0.955	0.947	2.667E-23	126	1.000	0.992	6b9xB.pdb.gz
3	AFDB:Q9V8I2	0.972	0.972	1.598E-20	125	0.696	0.696	Q9V8I2.pdb.gz	LTOR2_DROME Ragulator complex protein LAMTOR2 homolog OS=Drosophila melanogaster OX=7227 GN=Lamtor2 PE=1 SV=1
4	AFDB:Q9Y7J2	0.818	0.648	2.410E-9	160	0.288	0.225	Q9Y7J2.pdb.gz	YOI5_SCHPO Uncharacterized protein C1778.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1778.05c PE=4 SV=2
5	PDB:3t1rC	0.818	0.757	7.403E-8	136	0.152	0.140	3t1rC.pdb.gz	Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
6	AFDB:O50393	0.817	0.788	7.798E-8	130	0.184	0.177	O50393.pdb.gz	SPI_MYCTU Serine protease inhibitor Rv3364c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3364c PE=1 SV=1
7	AFDB:Q5SJ83	0.768	0.607	3.808E-7	163	0.192	0.147	Q5SJ83.pdb.gz	Q5SJ83_THET8 Probable gliding protein (MglB) OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA1131 PE=1 SV=1
8	PDB:5x6uA	0.705	0.710	3.843E-7	124	0.136	0.137	5x6uA.pdb.gz
9	PDB:6izwB	0.813	0.709	4.084E-7	145	0.120	0.103	6izwB.pdb.gz	Allosteric regulation of a prokaryotic small Ras-like GTPase contributes to cell polarity oscillations in bacterial motility.
10	AFDB:P38247	0.731	0.576	7.008E-7	162	0.168	0.130	P38247.pdb.gz	SLM4_YEAST Protein SLM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLM4 PE=1 SV=1
11	AFDB:O88653	0.785	0.791	1.213E-6	124	0.128	0.129	O88653.pdb.gz	LTOR3_MOUSE Ragulator complex protein LAMTOR3 OS=Mus musculus OX=10090 GN=Lamtor3 PE=1 SV=1
12	AFDB:Q9VJD2	0.696	0.701	1.549E-6	124	0.160	0.161	Q9VJD2.pdb.gz	LTOR3_DROME Ragulator complex protein LAMTOR3 homolog OS=Drosophila melanogaster OX=7227 GN=Lamtor3 PE=1 SV=1
13	PDB:3l9kA	0.635	0.820	1.563E-6	95	0.112	0.147	3l9kA.pdb.gz
14	AFDB:Q381D2	0.603	0.740	1.750E-6	98	0.176	0.224	Q381D2.pdb.gz	Q381D2_TRYB2 Dynein light chain roadblock OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8240 PE=3 SV=1
15	PDB:6jwpJ	0.734	0.648	1.995E-6	144	0.168	0.146	6jwpJ.pdb.gz	Structural insights into the EGO-TC-mediated membrane tethering of the TORC1-regulatory Rag GTPases.
16	AFDB:Q9SWQ6	0.647	0.756	2.233E-6	105	0.144	0.171	Q9SWQ6.pdb.gz	Q9SWQ6_CHLRE Dynein light chain roadblock OS=Chlamydomonas reinhardtii OX=3055 GN=LC7 PE=1 SV=1
17	PDB:7kzmI	0.629	0.749	1.686E-5	103	0.144	0.175	7kzmI.pdb.gz	Structure of a microtubule-bound axonemal dynein.
18	PDB:3d9yA	0.531	0.529	2.025E-5	126	0.152	0.151	3d9yA.pdb.gz
19	PDB:1k0kA	0.536	0.536	3.727E-5	125	0.168	0.168	1k0kA.pdb.gz
20	PDB:4ftxA	0.623	0.502	3.727E-5	158	0.144	0.114	4ftxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2Q5	5.53e-89	255	125	1.000	1.000	LTOR2_HUMAN Ragulator complex protein LAMTOR2 OS=Homo sapiens OX=9606 GN=LAMTOR2 PE=1 SV=1
2	Q9JHS3	2.20e-88	254	125	0.992	0.992	LTOR2_MOUSE Ragulator complex protein LAMTOR2 OS=Mus musculus OX=10090 GN=Lamtor2 PE=1 SV=1
3	Q9V8I2	2.08e-62	188	125	0.696	0.696	LTOR2_DROME Ragulator complex protein LAMTOR2 homolog OS=Drosophila melanogaster OX=7227 GN=Lamtor2 PE=1 SV=1
4	Q9Y7J2	0.001	38.5	160	0.168	0.131	YOI5_SCHPO Uncharacterized protein C1778.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1778.05c PE=4 SV=2
5	Q92834	0.16	33.5	1020	0.200	0.025	RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens OX=9606 GN=RPGR PE=1 SV=2
6	A0A8I6ANX7	0.70	31.6	685	0.256	0.047	A0A8I6ANX7_RAT Retinitis pigmentosa GTPase regulator OS=Rattus norvegicus OX=10116 GN=Rpgr PE=4 SV=1
7	B1WC72	0.70	31.6	677	0.256	0.047	B1WC72_RAT Rpgr protein OS=Rattus norvegicus OX=10116 GN=Rpgr PE=1 SV=1
8	A0A8I6A4C7	0.73	31.6	685	0.256	0.047	A0A8I6A4C7_RAT Retinitis pigmentosa GTPase regulator OS=Rattus norvegicus OX=10116 GN=Rpgr PE=4 SV=1
9	F7F384	0.87	31.2	729	0.256	0.044	F7F384_RAT Retinitis pigmentosa GTPase regulator OS=Rattus norvegicus OX=10116 GN=Rpgr PE=1 SV=1
10	A0A8I6AFA8	0.95	31.2	1035	0.256	0.031	A0A8I6AFA8_RAT Retinitis pigmentosa GTPase regulator OS=Rattus norvegicus OX=10116 GN=Rpgr PE=4 SV=1
11	O18475	2.2	30.0	2059	0.304	0.018	DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster OX=7227 GN=PolQ PE=1 SV=1
12	Q09843	2.4	29.6	340	0.152	0.056	RFC2_SCHPO Replication factor C subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc2 PE=1 SV=1
13	A0A8A1UD18	6.0	28.1	116	0.200	0.216	A0A8A1UD18_RAT Retinol-binding protein 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rbp3 PE=4 SV=1
14	Q9BMQ7	9.6	28.1	313	0.096	0.038	Q9BMQ7_BOMMO 35kDa protease OS=Bombyx mori OX=7091 GN=692590 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03259 Robl_LC7	3.1e-15	67.0	Roadblock/LC7 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008852037.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008824390.1	0.999	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
2	1026970.XP_008830607.1	0.999	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 4
3	1026970.XP_008838606.1	0.999	Solute carrier family 38 member 9
4	1026970.XP_008848576.1	0.999	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 5
5	1026970.XP_008843763.1	0.998	Ras related GTP binding A
6	1026970.XP_008852287.1	0.998	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 1
7	1026970.XP_008827484.1	0.996	Ras related GTP binding B
8	1026970.XP_008848450.1	0.993	Ras-related GTP-binding protein C
9	1026970.XP_008829852.1	0.990	Mechanistic target of rapamycin
10	1026970.XP_008826158.1	0.971	Regulatory-associated protein of mTOR-like
11	1026970.XP_008827036.1	0.971	Regulatory-associated protein of mTOR isoform X1
12	1026970.XP_008830055.1	0.964	Ras-related GTP-binding protein D
13	1026970.XP_008848415.1	0.891	ATPase H+ transporting V1 subunit B2
14	1026970.XP_008842877.1	0.881	Folliculin isoform X1
15	1026970.XP_008822917.1	0.873	ATPase H+ transporting V1 subunit B1
16	1026970.XP_008844599.1	0.854	ATPase H+ transporting V1 subunit F
17	1026970.XP_008852548.1	0.854	Folliculin-interacting protein 2
18	1026970.XP_008831712.1	0.849	ATPase H+ transporting V1 subunit G1
19	1026970.XP_008841073.1	0.846	ATPase H+ transporting V1 subunit A
20	1026970.XP_008834567.1	0.842	Mitogen-activated protein kinase kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0150116	0.997	regulation of cell-substrate junction organization
GO:0009967	0.997	positive regulation of signal transduction
GO:1902531	0.995	regulation of intracellular signal transduction
GO:1902533	0.994	positive regulation of intracellular signal transduction
GO:0008104	0.989	protein localization
GO:0051716	0.987	cellular response to stimulus
GO:0032006	0.977	regulation of TOR signaling
GO:0042221	0.953	response to chemical
GO:0032008	0.944	positive regulation of TOR signaling
GO:0001101	0.936	response to acid chemical
GO:0010243	0.915	response to organonitrogen compound
GO:0043200	0.912	response to amino acid
GO:1901701	0.894	cellular response to oxygen-containing compound
GO:0071229	0.889	cellular response to acid chemical
GO:0071417	0.877	cellular response to organonitrogen compound
GO:0071230	0.867	cellular response to amino acid stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0031090	0.997	organelle membrane
GO:0012505	0.994	endomembrane system
GO:0098588	0.993	bounding membrane of organelle
GO:0031982	0.992	vesicle
GO:0005765	0.983	lysosomal membrane
GO:0031410	0.981	cytoplasmic vesicle
GO:0098796	0.977	membrane protein complex
GO:0140535	0.975	intracellular protein-containing complex
GO:0005886	0.972	plasma membrane
GO:0005829	0.966	cytosol
GO:0005768	0.885	endosome
GO:0032045	0.840	guanyl-nucleotide exchange factor complex
GO:0042581	0.823	specific granule
GO:0030659	0.815	cytoplasmic vesicle membrane
GO:0035579	0.799	specific granule membrane
GO:0070821	0.746	tertiary granule membrane
GO:0010008	0.502	endosome membrane
GO:0005576	0.459	extracellular region
GO:0070013	0.371	intracellular organelle lumen
GO:0031981	0.353	nuclear lumen
GO:0005654	0.316	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]