StarFunc result for job id Q9Y2R2

User Input

>input (807 residues)
MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRY
KDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEY
SVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNS
ETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAI
DYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYELVYNAVLELFKRQMDVIRDK
HSGTESQAKHCIPEKNHTLQADSYSPNLPKSTTKAAKMMNQQRTKMEIKESSSFDFRTSE
ISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSL
LFEGCSNSKPVNAAGRYFNSKVPITRTKSTPFELIQQRETKEVDSKENFSYLESQPHDSC
FVEMQAQKVMHVSSAELNYSLPYDSKHQIRNASNVKHHDSSALGVYSYIPLVENPYFSSW
PPSGTSSKMSLDLPEKQDGTVFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQES
AVLATAPRIDDEIPPPLPVRTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSLEWGGTS
EPKKFDDSVILRPSKSVKLRSPKSELHQDRSSPPPPLPERTLESFFLADEDCMQAQSIET
YSTSYPDTMENSTSSKQTLKTPGKSFTRSKSLKILRNMKKSICNSCPPNKPAESVQSNNS
SSFLNFGFANRFSKPKGPRNPPPTWNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2R2	1.000	1.000	0.000	807	1.000	1.000	Q9Y2R2.pdb.gz	PTN22_HUMAN Tyrosine-protein phosphatase non-receptor type 22 OS=Homo sapiens OX=9606 GN=PTPN22 PE=1 SV=2
2	AFDB:P29352	0.496	0.498	3.845E-85	802	0.710	0.714	P29352.pdb.gz	PTN22_MOUSE Tyrosine-protein phosphatase non-receptor type 22 OS=Mus musculus OX=10090 GN=Ptpn22 PE=1 SV=1
3	AFDB:D4A2D5	0.475	0.476	5.125E-85	804	0.694	0.697	D4A2D5.pdb.gz	D4A2D5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn22 PE=1 SV=1
4	AFDB:Q05209	0.372	0.384	2.843E-48	780	0.346	0.358	Q05209.pdb.gz	PTN12_HUMAN Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12 PE=1 SV=3
5	AFDB:P35831	0.369	0.384	9.507E-48	775	0.354	0.369	P35831.pdb.gz	PTN12_MOUSE Tyrosine-protein phosphatase non-receptor type 12 OS=Mus musculus OX=10090 GN=Ptpn12 PE=1 SV=3
6	PDB:4gwfA	0.334	0.531	5.377E-26	497	0.133	0.215	4gwfA.pdb.gz
7	PDB:3ps5A	0.324	0.483	2.688E-25	529	0.144	0.219	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
8	PDB:5xzrA	0.334	0.509	3.371E-24	519	0.139	0.216	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
9	PDB:6krwA	0.329	0.829	1.502E-23	306	0.115	0.304	6krwA.pdb.gz
10	PDB:3m4uA	0.297	0.805	2.778E-18	285	0.100	0.284	3m4uA.pdb.gz
11	AFDB:Q6PB44	0.321	0.157	7.472E-12	1692	0.134	0.064	Q6PB44.pdb.gz	PTN23_MOUSE Tyrosine-protein phosphatase non-receptor type 23 OS=Mus musculus OX=10090 GN=Ptpn23 PE=1 SV=2
12	AFDB:A0A286YBL8	0.291	0.197	2.088E-9	1204	0.109	0.073	A0A286YBL8.pdb.gz	A0A286YBL8_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=1
13	AFDB:Q16825	0.290	0.202	3.697E-8	1174	0.110	0.076	Q16825.pdb.gz	PTN21_HUMAN Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens OX=9606 GN=PTPN21 PE=1 SV=2
14	AFDB:F1Q6T9	0.291	0.204	1.040E-7	1168	0.112	0.077	F1Q6T9.pdb.gz	F1Q6T9_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=2
15	PDB:4ercA	0.139	0.601	2.968E-4	150	0.038	0.207	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
16	PDB:3s4oA	0.139	0.572	3.143E-4	163	0.041	0.202	3s4oA.pdb.gz
17	PDB:7jvxA	0.161	0.386	3.329E-4	314	0.050	0.127	7jvxA.pdb.gz
18	PDB:5bx1A	0.133	0.599	5.273E-4	153	0.042	0.222	5bx1A.pdb.gz	Crystal Structure of PRL-1 complex with compound analogy 3
19	PDB:6wurA	0.142	0.624	1.249E-3	158	0.036	0.184	6wurA.pdb.gz
20	AFDB:Q9C0B9	0.080	0.065	1.210E-1	1178	0.124	0.085	Q9C0B9.pdb.gz	ZCHC2_HUMAN Zinc finger CCHC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZCCHC2 PE=1 SV=6

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A706	0.0	1072	803	0.682	0.685	A0A8I6A706_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn22 PE=3 SV=1
2	D4A2D5	0.0	1098	804	0.694	0.697	D4A2D5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn22 PE=1 SV=1
3	P29352	0.0	1142	802	0.710	0.714	PTN22_MOUSE Tyrosine-protein phosphatase non-receptor type 22 OS=Mus musculus OX=10090 GN=Ptpn22 PE=1 SV=1
4	Q9Y2R2	0.0	1671	807	1.000	1.000	PTN22_HUMAN Tyrosine-protein phosphatase non-receptor type 22 OS=Homo sapiens OX=9606 GN=PTPN22 PE=1 SV=2
5	Q63745	9.33e-140	420	382	0.233	0.492	Q63745_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn12 PE=1 SV=1
6	P35831	2.52e-137	427	775	0.234	0.244	PTN12_MOUSE Tyrosine-protein phosphatase non-receptor type 12 OS=Mus musculus OX=10090 GN=Ptpn12 PE=1 SV=3
7	G3V7Q4	4.14e-137	426	766	0.233	0.245	G3V7Q4_RAT Tyrosine-protein phosphatase non-receptor type 12 OS=Rattus norvegicus OX=10116 GN=Ptpn12 PE=1 SV=1
8	Q05209	4.19e-137	427	780	0.235	0.244	PTN12_HUMAN Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12 PE=1 SV=3
9	A0A0G2KAC5	2.66e-129	394	415	0.227	0.441	A0A0G2KAC5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn12 PE=1 SV=1
10	A0A8I5ZN71	2.14e-126	398	763	0.227	0.240	A0A8I5ZN71_RAT Tyrosine-protein phosphatase non-receptor type 12 OS=Rattus norvegicus OX=10116 GN=Ptpn12 PE=1 SV=1
11	P70602	3.35e-96	309	453	0.175	0.311	P70602_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn18 PE=1 SV=1
12	Q61152	2.30e-93	301	453	0.170	0.302	PTN18_MOUSE Tyrosine-protein phosphatase non-receptor type 18 OS=Mus musculus OX=10090 GN=Ptpn18 PE=1 SV=1
13	Q99952	4.97e-91	296	460	0.166	0.291	PTN18_HUMAN Tyrosine-protein phosphatase non-receptor type 18 OS=Homo sapiens OX=9606 GN=PTPN18 PE=1 SV=2
14	Q95Y26	1.13e-56	203	469	0.135	0.232	Q95Y26_CAEEL Protein-tyrosine-phosphatase OS=Caenorhabditis elegans OX=6239 GN=ptpn-22 PE=1 SV=2
15	F1LXJ9	1.41e-52	201	1454	0.126	0.070	F1LXJ9_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=1 SV=3
16	O14522	1.53e-52	201	1441	0.126	0.071	PTPRT_HUMAN Receptor-type tyrosine-protein phosphatase T OS=Homo sapiens OX=9606 GN=PTPRT PE=1 SV=6
17	Q99M80	1.63e-52	201	1454	0.126	0.070	PTPRT_MOUSE Receptor-type tyrosine-protein phosphatase T OS=Mus musculus OX=10090 GN=Ptprt PE=1 SV=2
18	Q64455	1.74e-52	200	1238	0.139	0.090	PTPRJ_MOUSE Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2
19	P08575	2.09e-52	200	1306	0.144	0.089	PTPRC_HUMAN Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens OX=9606 GN=PTPRC PE=1 SV=3
20	P06800	2.47e-52	200	1293	0.164	0.102	PTPRC_MOUSE Receptor-type tyrosine-protein phosphatase C OS=Mus musculus OX=10090 GN=Ptprc PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	1.8e+02	13.3	Dual specificity phosphatase, catalytic domain
2	PF00102 Y_phosphatase	1.7e-76	268.4	Protein-tyrosine phosphatase
3	PF13350 Y_phosphatase3	0.073	24.6	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352833

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220003	0.998	Tyrosine-protein kinase CSK
2	9606.ENSP00000337825	0.996	Tyrosine-protein kinase Lck
3	9606.ENSP00000353099	0.989	HLA class II histocompatibility antigen, DRB1-15 beta chain
4	9606.ENSP00000264972	0.988	Tyrosine-protein kinase ZAP-70
5	9606.ENSP00000362680	0.977	Proto-oncogene tyrosine-protein kinase Src
6	9606.ENSP00000354782	0.964	T-cell surface glycoprotein CD3 zeta chain
7	9606.ENSP00000011653	0.961	T-cell surface glycoprotein CD4
8	9606.ENSP00000454207	0.958	TNF receptor-associated factor 3
9	9606.ENSP00000364080	0.957	HLA class II histocompatibility antigen, DQ beta 1 chain
10	9606.ENSP00000339398	0.952	Major histocompatibility complex, class II, DQ alpha 1
11	9606.ENSP00000408146	0.945	HLA class II histocompatibility antigen, DP beta 1 chain
12	9606.ENSP00000364076	0.938	HLA class II histocompatibility antigen, DQ alpha 2 chain
13	9606.ENSP00000354566	0.935	T-cell surface glycoprotein CD3 epsilon chain
14	9606.ENSP00000378786	0.928	HLA class II histocompatibility antigen, DR alpha chain
15	9606.ENSP00000393566	0.923	HLA class II histocompatibility antigen, DP alpha 1 chain
16	9606.ENSP00000431445	0.923	T-cell surface glycoprotein CD3 gamma chain
17	9606.ENSP00000300692	0.919	T-cell surface glycoprotein CD3 delta chain
18	9606.ENSP00000364114	0.919	HLA class II histocompatibility antigen, DR beta 5 chain
19	9606.ENSP00000390431	0.909	Major histocompatibility complex, class II, DQ beta 2
20	9606.ENSP00000364597	0.902	Protein-arginine deiminase type-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0004725	0.999	protein tyrosine phosphatase activity
GO:0044389	0.852	ubiquitin-like protein ligase binding
GO:0031625	0.831	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0050896	0.975	response to stimulus
GO:0048522	0.938	positive regulation of cellular process
GO:0007165	0.936	signal transduction
GO:0001817	0.914	regulation of cytokine production
GO:0050778	0.908	positive regulation of immune response
GO:0002694	0.905	regulation of leukocyte activation
GO:0071704	0.894	organic substance metabolic process
GO:0002376	0.882	immune system process
GO:0044238	0.877	primary metabolic process
GO:0044237	0.877	cellular metabolic process
GO:0002831	0.867	regulation of response to biotic stimulus
GO:0051249	0.860	regulation of lymphocyte activation
GO:0031347	0.829	regulation of defense response
GO:0031401	0.823	positive regulation of protein modification process
GO:0002764	0.815	immune response-regulating signaling pathway
GO:0032101	0.812	regulation of response to external stimulus
GO:0001932	0.795	regulation of protein phosphorylation
GO:0032103	0.792	positive regulation of response to external stimulus
GO:0045088	0.778	regulation of innate immune response
GO:0042221	0.775	response to chemical
GO:0051338	0.766	regulation of transferase activity
GO:0010033	0.758	response to organic substance
GO:0006796	0.758	phosphate-containing compound metabolic process
GO:0006807	0.756	nitrogen compound metabolic process
GO:1902531	0.748	regulation of intracellular signal transduction
GO:0007166	0.728	cell surface receptor signaling pathway
GO:0071310	0.726	cellular response to organic substance
GO:0009968	0.721	negative regulation of signal transduction
GO:1901564	0.709	organonitrogen compound metabolic process
GO:0043170	0.704	macromolecule metabolic process
GO:0002683	0.699	negative regulation of immune system process
GO:0043408	0.687	regulation of MAPK cascade
GO:1902532	0.680	negative regulation of intracellular signal transduction
GO:0051240	0.673	positive regulation of multicellular organismal process
GO:0019538	0.672	protein metabolic process
GO:0045859	0.656	regulation of protein kinase activity
GO:0050730	0.652	regulation of peptidyl-tyrosine phosphorylation
GO:0036211	0.626	protein modification process
GO:0051049	0.607	regulation of transport
GO:0009892	0.588	negative regulation of metabolic process
GO:0010605	0.583	negative regulation of macromolecule metabolic process
GO:0051241	0.580	negative regulation of multicellular organismal process
GO:0044092	0.555	negative regulation of molecular function
GO:0062207	0.553	regulation of pattern recognition receptor signaling pathway
GO:0051172	0.528	negative regulation of nitrogen compound metabolic process
GO:0031324	0.524	negative regulation of cellular metabolic process
GO:0009967	0.524	positive regulation of signal transduction
GO:0071900	0.513	regulation of protein serine/threonine kinase activity
GO:0043409	0.504	negative regulation of MAPK cascade
GO:0010628	0.499	positive regulation of gene expression
GO:0030155	0.481	regulation of cell adhesion
GO:0009605	0.480	response to external stimulus
GO:0071495	0.477	cellular response to endogenous stimulus
GO:0051348	0.467	negative regulation of transferase activity
GO:0033673	0.420	negative regulation of kinase activity
GO:0031400	0.415	negative regulation of protein modification process
GO:0006469	0.412	negative regulation of protein kinase activity
GO:1902533	0.399	positive regulation of intracellular signal transduction
GO:0042127	0.393	regulation of cell population proliferation
GO:0071901	0.388	negative regulation of protein serine/threonine kinase activity
GO:0001819	0.382	positive regulation of cytokine production
GO:0032501	0.367	multicellular organismal process
GO:1903037	0.326	regulation of leukocyte cell-cell adhesion
GO:1903320	0.320	regulation of protein modification by small protein conjugation or removal
GO:0050863	0.312	regulation of T cell activation
GO:0009607	0.305	response to biotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.985	cytosol
GO:0005634	0.985	nucleus
GO:0098552	0.863	side of membrane
GO:0098562	0.755	cytoplasmic side of membrane
GO:0009898	0.506	cytoplasmic side of plasma membrane
GO:0048471	0.499	perinuclear region of cytoplasm
GO:0031974	0.430	membrane-enclosed lumen
GO:0043233	0.395	organelle lumen
GO:0070013	0.394	intracellular organelle lumen
GO:0031981	0.354	nuclear lumen
GO:0005654	0.343	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	0.999	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.999	protein-tyrosine-phosphatase.

[back to server]