StarFunc result for job id Q9Y2S2

User Input

>input (319 residues)
MASSAAGCVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAG
SLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILS
SSTSCLMPSKLFAGLVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIG
QCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSEGLGMRYAFIGPLET
MHLNAEGMLSYCDRYSEGIKHVLQTFGPIPEFSRATAEKVNQDMCMKVPDDPEHLAARRQ
WRDECLMRLAKLKSQVQPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2S2	1.000	1.000	9.740E-63	319	1.000	1.000	Q9Y2S2.pdb.gz	CRYL1_HUMAN Lambda-crystallin homolog OS=Homo sapiens OX=9606 GN=CRYL1 PE=1 SV=3
2	PDB:3f3sA	0.973	0.995	5.359E-59	312	0.975	0.997	3f3sA.pdb.gz	The Crystal Structure of Human Lambda-Crystallin, CRYL1
3	AFDB:Q99KP3	0.993	0.993	1.077E-56	319	0.840	0.840	Q99KP3.pdb.gz	CRYL1_MOUSE Lambda-crystallin homolog OS=Mus musculus OX=10090 GN=Cryl1 PE=1 SV=3
4	AFDB:P14755	0.994	0.994	1.722E-56	319	0.837	0.837	P14755.pdb.gz	CRYL1_RABIT Lambda-crystallin OS=Oryctolagus cuniculus OX=9986 GN=CRYL1 PE=1 SV=3
5	PDB:3adpA	0.964	0.992	1.808E-52	310	0.812	0.835	3adpA.pdb.gz	Crystal Structure of the Rabbit L-Gulonate 3-Dehydrogenase
6	AFDB:Q9VXI1	0.951	0.963	4.402E-42	315	0.498	0.505	Q9VXI1.pdb.gz	Q9VXI1_DROME Beta hydroxy acid dehydrogenase 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Had1 PE=1 SV=2
7	AFDB:Q9HTH8	0.811	0.806	5.492E-27	321	0.279	0.277	Q9HTH8.pdb.gz	LCDH_PSEAE L-carnitine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lcdH PE=1 SV=1
8	AFDB:D7URM0	0.804	0.799	1.325E-26	321	0.279	0.277	D7URM0.pdb.gz	LCDH_PSESP L-carnitine dehydrogenase OS=Pseudomonas sp. OX=306 GN=lcdH PE=1 SV=1
9	AFDB:D7UNT2	0.806	0.534	1.755E-25	497	0.304	0.195	D7UNT2.pdb.gz	LCDH_RHISP L-carnitine dehydrogenase OS=Rhizobium sp. OX=391 GN=lcdH PE=1 SV=1
10	AFDB:C1BI43	0.687	0.708	2.668E-21	309	0.219	0.227	C1BI43.pdb.gz	C1BI43_ONCMY Short chain 3-hydroxyacyl-CoA dehydrogenase, mitochondrial OS=Oncorhynchus mykiss OX=8022 GN=HCDH PE=2 SV=1
11	AFDB:Q61425	0.686	0.696	2.963E-20	314	0.229	0.232	Q61425.pdb.gz	HCDH_MOUSE Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Hadh PE=1 SV=2
12	PDB:3rqsB	0.669	0.675	3.470E-20	316	0.216	0.218	3rqsB.pdb.gz
13	AFDB:Q9LDF5	0.666	0.721	4.470E-20	294	0.219	0.238	Q9LDF5.pdb.gz	Q9LDF5_ARATH 3-hydroxyacyl-CoA dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g15290 PE=1 SV=1
14	PDB:3mogC	0.663	0.453	2.115E-18	472	0.229	0.155	3mogC.pdb.gz
15	PDB:6hrdA	0.655	0.730	1.032E-17	285	0.204	0.228	6hrdA.pdb.gz
16	PDB:6ysvA	0.567	0.263	5.667E-17	708	0.210	0.095	6ysvA.pdb.gz
17	PDB:4b3iA	0.656	0.297	8.547E-17	731	0.207	0.090	4b3iA.pdb.gz	Structure of Mycobacterial Beta-Oxidation Trifunctional Enzyme Reveals its Altered Assembly and Putative Substrate Channeling Pathway.
18	PDB:2wtbA	0.595	0.285	2.766E-16	676	0.150	0.071	2wtbA.pdb.gz
19	PDB:6dv2G	0.638	0.291	3.299E-16	725	0.182	0.080	6dv2G.pdb.gz
20	PDB:3zwaA	0.611	0.279	5.276E-16	727	0.216	0.095	3zwaA.pdb.gz	The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P14755	0.0	536	319	0.837	0.837	CRYL1_RABIT Lambda-crystallin OS=Oryctolagus cuniculus OX=9986 GN=CRYL1 PE=1 SV=3
2	Q99KP3	0.0	542	319	0.840	0.840	CRYL1_MOUSE Lambda-crystallin homolog OS=Mus musculus OX=10090 GN=Cryl1 PE=1 SV=3
3	Q9Y2S2	0.0	659	319	1.000	1.000	CRYL1_HUMAN Lambda-crystallin homolog OS=Homo sapiens OX=9606 GN=CRYL1 PE=1 SV=3
4	Q9VXI1	1.62e-112	330	315	0.502	0.508	Q9VXI1_DROME Beta hydroxy acid dehydrogenase 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Had1 PE=1 SV=2
5	D7URM0	9.43e-42	149	321	0.285	0.283	LCDH_PSESP L-carnitine dehydrogenase OS=Pseudomonas sp. OX=306 GN=lcdH PE=1 SV=1
6	D7UNT2	5.18e-40	148	497	0.295	0.189	LCDH_RHISP L-carnitine dehydrogenase OS=Rhizobium sp. OX=391 GN=lcdH PE=1 SV=1
7	Q9HTH8	3.12e-39	142	321	0.292	0.290	LCDH_PSEAE L-carnitine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lcdH PE=1 SV=1
8	P76083	1.11e-22	100	475	0.226	0.152	PAAH_ECOLI 3-hydroxyadipyl-CoA dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=paaH PE=1 SV=1
9	Q9LDF5	3.20e-21	93.6	294	0.207	0.224	Q9LDF5_ARATH 3-hydroxyacyl-CoA dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g15290 PE=1 SV=1
10	P00348	3.35e-20	91.3	314	0.219	0.223	HCDH_PIG Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Sus scrofa OX=9823 GN=HADH PE=1 SV=2
11	A0A140VK76	9.88e-20	89.7	314	0.207	0.210	A0A140VK76_HUMAN Testis secretory sperm-binding protein Li 203a OS=Homo sapiens OX=9606 PE=2 SV=1
12	Q16836	9.88e-20	89.7	314	0.207	0.210	HCDH_HUMAN Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=3
13	Q61425	2.02e-19	89.0	314	0.204	0.207	HCDH_MOUSE Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Hadh PE=1 SV=2
14	Q9WVK7	8.52e-19	87.4	314	0.201	0.204	HCDH_RAT Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hadh PE=2 SV=1
15	A0A0A0MSE2	4.22e-18	85.5	317	0.207	0.208	A0A0A0MSE2_HUMAN Hydroxyacyl-CoA dehydrogenase OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=2
16	C1BI43	2.86e-17	82.8	309	0.197	0.204	C1BI43_ONCMY Short chain 3-hydroxyacyl-CoA dehydrogenase, mitochondrial OS=Oncorhynchus mykiss OX=8022 GN=HCDH PE=2 SV=1
17	P77399	3.60e-17	84.3	714	0.197	0.088	FADJ_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=fadJ PE=1 SV=1
18	Q9DBM2	1.48e-16	82.4	718	0.213	0.095	ECHP_MOUSE Peroxisomal bifunctional enzyme OS=Mus musculus OX=10090 GN=Ehhadh PE=1 SV=4
19	A0A0D9SFP2	4.74e-16	79.7	318	0.191	0.192	A0A0D9SFP2_HUMAN Hydroxyacyl-CoA dehydrogenase OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=1
20	E9PF18	8.59e-16	79.3	390	0.207	0.169	E9PF18_HUMAN Hydroxyacyl-CoA dehydrogenase OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	32	15.3	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF00725 3HCDH	3.7e-12	57.9	3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
3	PF02737 3HCDH_N	4.8e-47	171.7	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
4	PF00106 adh_short	5.6e+02	11.4	short chain dehydrogenase
5	PF01262 AlaDh_PNT_C	1.7e+02	12.9	Alanine dehydrogenase/PNT, C-terminal domain
6	PF02558 ApbA	2.6e+02	12.6	Ketopantoate reductase PanE/ApbA
7	PF00056 Ldh_1_N	86	14.7	lactate/malate dehydrogenase, NAD binding domain
8	PF03446 NAD_binding_2	2.4	19.8	NAD binding domain of 6-phosphogluconate dehydrogenase
9	PF01210 NAD_Gly3P_dh_N	34	15.8	NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
10	PF00070 Pyr_redox	6e+02	12.4	Pyridine nucleotide-disulphide oxidoreductase
11	PF03721 UDPG_MGDP_dh_N	13	16.9	UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298248

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361140	0.916	Alcohol dehydrogenase [NADP(+)]
2	9606.ENSP00000370966	0.723	Quinone oxidoreductase-like protein 1
3	9606.ENSP00000241125	0.717	Gap junction alpha-3 protein
4	9606.ENSP00000369461	0.713	Enoyl-CoA delta isomerase 2, mitochondrial
5	9606.ENSP00000387365	0.701	Periodic tryptophan protein 1 homolog
6	9606.ENSP00000415556	0.695	DDB1- and CUL4-associated factor 11
7	9606.ENSP00000479598	0.694	RAD9, HUS1, RAD1-interacting nuclear orphan protein 1
8	9606.ENSP00000286371	0.693	Sodium/potassium-transporting ATPase subunit beta-3
9	9606.ENSP00000372295	0.684	Gap junction beta-2 protein
10	9606.ENSP00000242465	0.680	Serglycin
11	9606.ENSP00000363869	0.680	V-set and immunoglobulin domain-containing protein 4
12	9606.ENSP00000370737	0.680	Glycine dehydrogenase (decarboxylating), mitochondrial
13	9606.ENSP00000266556	0.679	Tapasin-related protein
14	9606.ENSP00000296161	0.678	E3 ubiquitin-protein ligase DTX3L
15	9606.ENSP00000237696	0.676	Retinoic acid receptor responder protein 1
16	9606.ENSP00000352603	0.676	AP-4 complex subunit mu-1
17	9606.ENSP00000352208	0.674	Myoferlin
18	9606.ENSP00000348521	0.670	Gap junction beta-6 protein
19	9606.ENSP00000263918	0.668	Striatin
20	9606.ENSP00000462729	0.668	OTU domain-containing protein 7B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016616	1.000	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0042803	1.000	protein homodimerization activity
GO:0070403	1.000	NAD+ binding
GO:0050104	0.848	L-gulonate 3-dehydrogenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0044248	0.970	cellular catabolic process
GO:0032787	0.958	monocarboxylic acid metabolic process
GO:0046395	0.947	carboxylic acid catabolic process
GO:0072329	0.791	monocarboxylic acid catabolic process
GO:0009058	0.761	biosynthetic process
GO:1901135	0.678	carbohydrate derivative metabolic process
GO:0006793	0.674	phosphorus metabolic process
GO:0019637	0.630	organophosphate metabolic process
GO:0044238	0.602	primary metabolic process
GO:1901576	0.373	organic substance biosynthetic process
GO:0006796	0.372	phosphate-containing compound metabolic process
GO:0065007	0.309	biological regulation
GO:0006807	0.307	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043227	0.974	membrane-bounded organelle
GO:0005576	0.847	extracellular region
GO:0043231	0.800	intracellular membrane-bounded organelle
GO:0031982	0.774	vesicle
GO:0005615	0.726	extracellular space
GO:0070062	0.660	extracellular exosome
GO:0070013	0.566	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.-	1.000	With NAD(+) or NADP(+) as acceptor.
RHEA:12889	0.848	L-gulonate + NAD(+) = 3-dehydro-L-gulonate + H(+) + NADH
EC:1.1.1.45	0.848	L-gulonate 3-dehydrogenase.

[back to server]