StarFunc result for job id Q9Y2T1

User Input

>input (843 residues)
MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMSVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSL
LPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVH
CFCPGGSEYYCYSKCKSHSKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAP
GGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRH
HLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQ
QRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVE
RID

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2T1	1.000	1.000	0.000	843	1.000	1.000	Q9Y2T1.pdb.gz	AXIN2_HUMAN Axin-2 OS=Homo sapiens OX=9606 GN=AXIN2 PE=1 SV=2
2	AFDB:O35625	0.243	0.238	3.130E-58	863	0.460	0.450	O35625.pdb.gz	AXIN1_MOUSE Axin-1 OS=Mus musculus OX=10090 GN=Axin1 PE=1 SV=3
3	AFDB:Q14DJ8	0.170	0.172	2.303E-57	832	0.451	0.457	Q14DJ8.pdb.gz	Q14DJ8_MOUSE Axin 1 OS=Mus musculus OX=10090 GN=Axin1 PE=1 SV=1
4	AFDB:Q9YGY0	0.197	0.197	2.521E-55	842	0.440	0.441	Q9YGY0.pdb.gz	AXIN1_XENLA Axin-1 OS=Xenopus laevis OX=8355 GN=axin1 PE=1 SV=1
5	AFDB:Q9PTP2	0.163	0.194	2.296E-48	706	0.376	0.449	Q9PTP2.pdb.gz	AXNR_XENLA Axin-related protein OS=Xenopus laevis OX=8355 PE=1 SV=1
6	PDB:1agrE	0.141	0.881	5.091E-8	128	0.040	0.266	1agrE.pdb.gz	Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
7	AFDB:Q9VCX1	0.154	0.087	2.683E-7	1541	0.135	0.074	Q9VCX1.pdb.gz	RGS_DROME Regulator of G-protein signaling loco OS=Drosophila melanogaster OX=7227 GN=loco PE=1 SV=2
8	PDB:7shfC	0.143	0.294	3.646E-5	400	0.037	0.077	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
9	PDB:4mk0A	0.139	0.182	4.890E-5	631	0.025	0.033	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
10	PDB:3pvuA	0.140	0.189	7.821E-5	609	0.028	0.039	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
11	PDB:4yhjA	0.136	0.221	4.046E-4	501	0.025	0.042	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
12	AFDB:O77086	0.064	0.040	4.635E-4	1571	0.157	0.084	O77086.pdb.gz	C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster OX=7227 GN=C3G PE=1 SV=4
13	PDB:3c4wB	0.129	0.202	5.426E-4	519	0.036	0.058	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
14	PDB:6pjxA	0.134	0.202	1.035E-3	543	0.027	0.042	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
15	AFDB:Q5U2Y9	0.059	0.065	1.257E-3	727	0.132	0.153	Q5U2Y9.pdb.gz	LCA5_RAT Lebercilin OS=Rattus norvegicus OX=10116 GN=Lca5 PE=2 SV=1
16	AFDB:A0A0B4KEH2	0.055	0.055	2.132E-3	839	0.100	0.100	A0A0B4KEH2.pdb.gz	A0A0B4KEH2_DROME KCNQ potassium channel, isoform I OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
17	AFDB:A6NGG8	0.068	0.052	3.216E-3	1288	0.172	0.113	A6NGG8.pdb.gz	PCARE_HUMAN Photoreceptor cilium actin regulator OS=Homo sapiens OX=9606 GN=PCARE PE=1 SV=1
18	PDB:4gouA	0.136	0.219	6.771E-3	507	0.033	0.055	4gouA.pdb.gz
19	PDB:3nynA	0.135	0.200	1.083E-2	554	0.023	0.034	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
20	PDB:2hdeA	0.083	0.370	5.602E-2	148	0.020	0.115	2hdeA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15169	0.0	565	862	0.453	0.443	AXIN1_HUMAN Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1 PE=1 SV=2
2	O35625	0.0	576	863	0.461	0.451	AXIN1_MOUSE Axin-1 OS=Mus musculus OX=10090 GN=Axin1 PE=1 SV=3
3	O70239	0.0	566	827	0.447	0.456	AXIN1_RAT Axin-1 OS=Rattus norvegicus OX=10116 GN=Axin1 PE=1 SV=3
4	O70240	0.0	1522	838	0.900	0.906	AXIN2_RAT Axin-2 OS=Rattus norvegicus OX=10116 GN=Axin2 PE=1 SV=1
5	O88566	0.0	1521	840	0.899	0.902	AXIN2_MOUSE Axin-2 OS=Mus musculus OX=10090 GN=Axin2 PE=1 SV=2
6	P57094	0.0	563	835	0.447	0.451	AXIN1_DANRE Axin-1 OS=Danio rerio OX=7955 GN=axin1 PE=1 SV=2
7	P57095	0.0	936	812	0.639	0.664	AXIN2_DANRE Axin-2 OS=Danio rerio OX=7955 GN=axin2 PE=1 SV=1
8	Q14DJ8	0.0	561	832	0.450	0.456	Q14DJ8_MOUSE Axin 1 OS=Mus musculus OX=10090 GN=Axin1 PE=1 SV=1
9	Q9Y2T1	0.0	1747	843	0.999	0.999	AXIN2_HUMAN Axin-2 OS=Homo sapiens OX=9606 GN=AXIN2 PE=1 SV=2
10	Q9YGY0	0.0	562	842	0.434	0.435	AXIN1_XENLA Axin-1 OS=Xenopus laevis OX=8355 GN=axin1 PE=1 SV=1
11	Q9PTP2	9.36e-152	463	706	0.397	0.475	AXNR_XENLA Axin-related protein OS=Xenopus laevis OX=8355 PE=1 SV=1
12	A0A0S2Z4M1	6.52e-134	419	779	0.388	0.420	A0A0S2Z4M1_HUMAN Axin 1 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=AXIN1 PE=1 SV=1
13	Q9NS28	2.38e-16	81.6	235	0.064	0.230	RGS18_HUMAN Regulator of G-protein signaling 18 OS=Homo sapiens OX=9606 GN=RGS18 PE=1 SV=1
14	Q99PG4	1.52e-14	76.3	235	0.055	0.196	RGS18_MOUSE Regulator of G-protein signaling 18 OS=Mus musculus OX=10090 GN=Rgs18 PE=1 SV=1
15	Q6TEM0	3.93e-14	74.7	215	0.052	0.205	Q6TEM0_DANRE Regulator of G-protein signaling 4 OS=Danio rerio OX=7955 GN=RGS4 PE=2 SV=1
16	P49797	4.02e-14	79.0	967	0.055	0.048	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
17	P49796	4.94e-14	79.0	1198	0.058	0.041	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2
18	A0A087WUY2	1.42e-13	72.4	192	0.058	0.255	A0A087WUY2_HUMAN Regulator of G protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=1
19	Q2M5E4	2.02e-13	70.9	152	0.049	0.270	RGS21_HUMAN Regulator of G-protein signaling 21 OS=Homo sapiens OX=9606 GN=RGS21 PE=2 SV=1
20	V9GXQ3	2.18e-13	70.5	152	0.050	0.276	V9GXQ3_MOUSE Regulator of G protein Signaling 21 variant 1 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16646 AXIN1_TNKS_BD	2e-21	87.7	Axin-1 tankyrase binding domain
2	PF08833 Axin_b-cat_bind	5.3e-15	66.3	Axin beta-catenin binding motif
3	PF00778 DIX	5.2e-23	92.0	DIX domain
4	PF00615 RGS	4.2e-24	96.5	Regulator of G protein signaling domain
5	PF09432 THP2	9.2e+02	11.3	Tho complex subunit THP2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302625

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257430	0.999	Adenomatous polyposis coli protein
2	9606.ENSP00000324806	0.999	Glycogen synthase kinase-3 beta
3	9606.ENSP00000344456	0.999	Catenin beta-1
4	9606.ENSP00000368169	0.994	Segment polarity protein dishevelled homolog DVL-1
5	9606.ENSP00000265165	0.987	Lymphoid enhancer-binding factor 1
6	9606.ENSP00000358404	0.987	Transcription factor 7-like 2
7	9606.ENSP00000222330	0.971	Glycogen synthase kinase-3 alpha
8	9606.ENSP00000442954	0.969	Adenomatous polyposis coli protein 2
9	9606.ENSP00000340347	0.964	Transcription factor 7
10	9606.ENSP00000311579	0.962	Tankyrase-1
11	9606.ENSP00000282111	0.955	Transcription factor 7-like 1
12	9606.ENSP00000262320	0.953	Axin-1
13	9606.ENSP00000421689	0.942	Casein kinase I isoform alpha
14	9606.ENSP00000005340	0.938	Segment polarity protein dishevelled homolog DVL-2
15	9606.ENSP00000360689	0.935	Tankyrase-2
16	9606.ENSP00000316054	0.931	Segment polarity protein dishevelled homolog DVL-3
17	9606.ENSP00000272317	0.925	Ubiquitin-40S ribosomal protein S27a
18	9606.ENSP00000369126	0.915	Casein kinase I isoform alpha-like
19	9606.ENSP00000357297	0.913	E3 ubiquitin-protein ligase RNF146
20	9606.ENSP00000380044	0.912	Casein kinase I isoform epsilon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0031625	0.977	ubiquitin protein ligase binding
GO:0042802	0.473	identical protein binding
GO:0008013	0.356	beta-catenin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0030111	0.988	regulation of Wnt signaling pathway
GO:0048519	0.985	negative regulation of biological process
GO:0048523	0.984	negative regulation of cellular process
GO:0050793	0.981	regulation of developmental process
GO:0019222	0.976	regulation of metabolic process
GO:0048518	0.974	positive regulation of biological process
GO:0051171	0.969	regulation of nitrogen compound metabolic process
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:0030178	0.968	negative regulation of Wnt signaling pathway
GO:0080090	0.967	regulation of primary metabolic process
GO:0009893	0.964	positive regulation of metabolic process
GO:0051239	0.952	regulation of multicellular organismal process
GO:0032502	0.943	developmental process
GO:0051173	0.939	positive regulation of nitrogen compound metabolic process
GO:0048856	0.929	anatomical structure development
GO:0048522	0.914	positive regulation of cellular process
GO:0031323	0.914	regulation of cellular metabolic process
GO:0050896	0.909	response to stimulus
GO:0010604	0.905	positive regulation of macromolecule metabolic process
GO:0031325	0.899	positive regulation of cellular metabolic process
GO:0051247	0.897	positive regulation of protein metabolic process
GO:0045595	0.887	regulation of cell differentiation
GO:0060828	0.884	regulation of canonical Wnt signaling pathway
GO:0051174	0.879	regulation of phosphorus metabolic process
GO:0031401	0.865	positive regulation of protein modification process
GO:0090090	0.861	negative regulation of canonical Wnt signaling pathway
GO:0045937	0.851	positive regulation of phosphate metabolic process
GO:0065009	0.846	regulation of molecular function
GO:0042127	0.843	regulation of cell population proliferation
GO:0042325	0.835	regulation of phosphorylation
GO:0048513	0.819	animal organ development
GO:0019219	0.817	regulation of nucleobase-containing compound metabolic process
GO:0051716	0.785	cellular response to stimulus
GO:0010468	0.784	regulation of gene expression
GO:0051252	0.706	regulation of RNA metabolic process
GO:0032501	0.673	multicellular organismal process
GO:0051093	0.667	negative regulation of developmental process
GO:0009653	0.649	anatomical structure morphogenesis
GO:0001932	0.642	regulation of protein phosphorylation
GO:0009892	0.612	negative regulation of metabolic process
GO:0010605	0.585	negative regulation of macromolecule metabolic process
GO:0051172	0.572	negative regulation of nitrogen compound metabolic process
GO:0007275	0.555	multicellular organism development
GO:0031324	0.542	negative regulation of cellular metabolic process
GO:0008152	0.538	metabolic process
GO:0010556	0.536	regulation of macromolecule biosynthetic process
GO:0031326	0.535	regulation of cellular biosynthetic process
GO:0007154	0.528	cell communication
GO:0007165	0.517	signal transduction
GO:0071704	0.464	organic substance metabolic process
GO:0044238	0.455	primary metabolic process
GO:0051094	0.444	positive regulation of developmental process
GO:0048731	0.427	system development
GO:0042327	0.423	positive regulation of phosphorylation
GO:0045935	0.411	positive regulation of nucleobase-containing compound metabolic process
GO:1903506	0.388	regulation of nucleic acid-templated transcription
GO:0071840	0.383	cellular component organization or biogenesis
GO:0045934	0.377	negative regulation of nucleobase-containing compound metabolic process
GO:0031328	0.368	positive regulation of cellular biosynthetic process
GO:0010557	0.367	positive regulation of macromolecule biosynthetic process
GO:0008285	0.357	negative regulation of cell population proliferation
GO:0006355	0.355	regulation of DNA-templated transcription
GO:0045597	0.348	positive regulation of cell differentiation
GO:0006807	0.342	nitrogen compound metabolic process
GO:0016043	0.333	cellular component organization
GO:0051254	0.330	positive regulation of RNA metabolic process
GO:0048584	0.325	positive regulation of response to stimulus
GO:0043170	0.319	macromolecule metabolic process
GO:0001934	0.319	positive regulation of protein phosphorylation
GO:0044237	0.316	cellular metabolic process
GO:0009967	0.303	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005829	0.993	cytosol
GO:0032991	0.991	protein-containing complex
GO:0005856	0.968	cytoskeleton
GO:0070013	0.945	intracellular organelle lumen
GO:0015630	0.935	microtubule cytoskeleton
GO:0016020	0.914	membrane
GO:0005815	0.870	microtubule organizing center
GO:0005813	0.816	centrosome
GO:0071944	0.807	cell periphery
GO:0031981	0.481	nuclear lumen
GO:0005886	0.392	plasma membrane
GO:0005654	0.374	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]