StarFunc result for job id Q9Y2T3

User Input

>input (454 residues)
MCAAQMPPLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCF
KPCEIRELSHHEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFA
EEVYTRVVRRTLKNGTTTACYFATIHTDSSLLLADITDKFGQRAFVGKVCMDLNDTFPEY
KETTEESIKETERFVSEMLQKNYSRVKPIVTPRFSLSCSETLMGELGNIAKTRDLHIQSH
ISENRDEVEAVKNLYPSYKNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAH
CPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVSNILLINKVNE
KSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDI
SEAVIQKFLYLGDDRNIEEVYVGGKQVVPFSSSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9R111	0.992	0.992	4.361E-87	454	0.907	0.907	Q9R111.pdb.gz	GUAD_MOUSE Guanine deaminase OS=Mus musculus OX=10090 GN=Gda PE=1 SV=1
2	PDB:2uz9A	0.971	0.993	2.595E-85	444	0.978	1.000	2uz9A.pdb.gz	Human Guanine Deaminase (Guad) in Complex with Zinc and its Product Xhantine
3	AFDB:Q9VMY9	0.897	0.909	8.554E-54	448	0.430	0.435	Q9VMY9.pdb.gz	GUAD_DROME Guanine deaminase OS=Drosophila melanogaster OX=7227 GN=DhpD PE=1 SV=1
4	PDB:6oh9A	0.918	0.922	1.924E-52	452	0.392	0.394	6oh9A.pdb.gz	Structural Determinants for Substrate Selectivity in Guanine Deaminase Enzymes of the Amidohydrolase Superfamily.
5	AFDB:O14057	0.910	0.786	1.049E-51	527	0.412	0.355	O14057.pdb.gz	GUAD_SCHPO Probable guanine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1672.03c PE=3 SV=1
6	AFDB:Q07729	0.911	0.847	1.546E-50	489	0.396	0.368	Q07729.pdb.gz	GUAD_YEAST Probable guanine deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUD1 PE=1 SV=1
7	AFDB:Q2UHY8	0.937	0.933	9.421E-48	456	0.374	0.373	Q2UHY8.pdb.gz	Q2UHY8_ASPOR Guanine deaminase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000256 PE=3 SV=1
8	AFDB:Q57X48	0.897	0.792	1.193E-43	516	0.335	0.295	Q57X48.pdb.gz	Q57X48_TRYB2 Guanine deaminase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26C7.180 PE=3 SV=1
9	AFDB:P76641	0.842	0.870	9.023E-40	439	0.326	0.337	P76641.pdb.gz	GUAD_ECOLI Guanine deaminase OS=Escherichia coli (strain K12) OX=83333 GN=guaD PE=1 SV=1
10	PDB:6ohbA	0.834	0.869	1.144E-38	435	0.322	0.336	6ohbA.pdb.gz	Structural Determinants for Substrate Selectivity in Guanine Deaminase Enzymes of the Amidohydrolase Superfamily.
11	PDB:4dzhA	0.795	0.821	4.497E-33	439	0.233	0.241	4dzhA.pdb.gz	Crystal structure of an adenosine deaminase from xanthomonas campestris (target nysgrc-200456) with bound zn
12	AFDB:Q8P8H1	0.820	0.829	5.861E-33	449	0.236	0.238	Q8P8H1.pdb.gz	Q8P8H1_XANCP Amidohydrolase-related domain-containing protein OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC2270 PE=1 SV=1
13	PDB:4f0rA	0.811	0.843	1.175E-31	436	0.238	0.248	4f0rA.pdb.gz	Crystal structure of an adenosine deaminase homolog from Chromobacterium violaceum (target NYSGRC-019589) bound Zn and 5'-Methylthioadenosine (unproductive complex)
14	PDB:4dykA	0.795	0.824	1.858E-31	437	0.238	0.247	4dykA.pdb.gz	Crystal structure of an adenosine deaminase from pseudomonas aeruginosa pao1 (target nysgrc-200449) with bound zn
15	AFDB:Q7NZ90	0.802	0.828	2.422E-31	439	0.236	0.244	Q7NZ90.pdb.gz	Q7NZ90_CHRVO 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=mtaD PE=1 SV=1
16	AFDB:Q9HZ64	0.800	0.817	3.829E-31	444	0.240	0.245	Q9HZ64.pdb.gz	Q9HZ64_PSEAE Amidohydrolase-related domain-containing protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA3170 PE=1 SV=1
17	PDB:4l9xB	0.793	0.786	1.415E-23	458	0.174	0.172	4l9xB.pdb.gz
18	PDB:4rdvB	0.755	0.760	6.271E-23	451	0.170	0.171	4rdvB.pdb.gz	The structure of N-formimino-L-Glutamate Iminohydrolase from Pseudomonas aeruginosa complexed with N-formimino-L-Aspartate
19	PDB:1j6pA	0.714	0.792	1.861E-22	407	0.194	0.216	1j6pA.pdb.gz
20	PDB:4c5yA	0.548	0.567	1.550E-12	436	0.161	0.167	4c5yA.pdb.gz	Structural and Functional Characterization of Ochratoxinase, a Novel Mycotoxin Degrading Enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9R111	0.0	847	454	0.907	0.907	GUAD_MOUSE Guanine deaminase OS=Mus musculus OX=10090 GN=Gda PE=1 SV=1
2	Q9WTT6	0.0	835	454	0.903	0.903	GUAD_RAT Guanine deaminase OS=Rattus norvegicus OX=10116 GN=Gda PE=1 SV=1
3	Q9Y2T3	0.0	946	454	1.000	1.000	GUAD_HUMAN Guanine deaminase OS=Homo sapiens OX=9606 GN=GDA PE=1 SV=1
4	Q9VMY9	7.68e-117	351	448	0.434	0.440	GUAD_DROME Guanine deaminase OS=Drosophila melanogaster OX=7227 GN=DhpD PE=1 SV=1
5	O14057	4.67e-109	334	527	0.405	0.349	GUAD_SCHPO Probable guanine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1672.03c PE=3 SV=1
6	Q07729	1.08e-99	308	489	0.368	0.342	GUAD_YEAST Probable guanine deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUD1 PE=1 SV=1
7	Q2UHY8	1.09e-93	292	456	0.377	0.375	Q2UHY8_ASPOR Guanine deaminase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000256 PE=3 SV=1
8	P76641	1.26e-69	229	439	0.308	0.319	GUAD_ECOLI Guanine deaminase OS=Escherichia coli (strain K12) OX=83333 GN=guaD PE=1 SV=1
9	Q57X48	4.17e-66	222	516	0.311	0.273	Q57X48_TRYB2 Guanine deaminase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26C7.180 PE=3 SV=1
10	Q9HZ64	3.65e-35	137	444	0.253	0.259	Q9HZ64_PSEAE Amidohydrolase-related domain-containing protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA3170 PE=1 SV=1
11	Q8P8H1	1.90e-34	135	449	0.247	0.249	Q8P8H1_XANCP Amidohydrolase-related domain-containing protein OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC2270 PE=1 SV=1
12	Q8PUQ3	4.49e-33	131	432	0.240	0.252	DADD_METMA 5'-deoxyadenosine deaminase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) OX=192952 GN=dadD PE=3 SV=2
13	Q81F14	1.29e-30	124	435	0.225	0.234	MTAD_BACCR 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=mtaD PE=3 SV=1
14	Q92342	3.14e-29	121	463	0.231	0.227	YDI4_SCHPO Uncharacterized protein C1F8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F8.04c PE=3 SV=1
15	Q7NZ90	4.20e-29	120	439	0.225	0.232	Q7NZ90_CHRVO 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=mtaD PE=1 SV=1
16	Q72B14	6.83e-29	120	442	0.207	0.213	MTAD_DESVH 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=mtaD PE=3 SV=1
17	A3DEQ2	4.42e-20	94.4	431	0.203	0.213	MTAD_ACET2 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=mtaD PE=3 SV=1
18	Q9X034	9.27e-14	75.1	406	0.174	0.195	MTAD_THEMA 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=mtaD PE=1 SV=1
19	Q97BE1	6.06e-10	63.2	418	0.170	0.184	Q97BE1_THEVO Amidohydrolase-related domain-containing protein OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) OX=273116 GN=TVG0503027 PE=4 SV=1
20	Q6SJY7	8.68e-09	59.7	469	0.174	0.168	Q6SJY7_PAEAU Triazine hydrolase OS=Paenarthrobacter aurescens OX=43663 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01979 Amidohydro_1	2.9e-73	258.8	Amidohydrolase family
2	PF07969 Amidohydro_3	2.8e-07	42.0	Amidohydrolase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000238018

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354532	0.983	Purine nucleoside phosphorylase
2	9606.ENSP00000357674	0.978	SNARE-associated protein Snapin
3	9606.ENSP00000367615	0.972	Adenine phosphoribosyltransferase
4	9606.ENSP00000368727	0.969	Xanthine dehydrogenase/oxidase
5	9606.ENSP00000298556	0.945	Hypoxanthine-guanine phosphoribosyltransferase
6	9606.ENSP00000382428	0.942	Disks large homolog 4
7	9606.ENSP00000363480	0.892	Disks large homolog 3
8	9606.ENSP00000244137	0.833	Xaa-Pro dipeptidase
9	9606.ENSP00000361965	0.827	Adenosine deaminase
10	9606.ENSP00000485525	0.812	Adenylosuccinate lyase
11	9606.ENSP00000321606	0.786	Dihydropyrimidinase-related protein 1
12	9606.ENSP00000351646	0.782	Stress-induced-phosphoprotein 1
13	9606.ENSP00000345731	0.762	Disks large homolog 1
14	9606.ENSP00000259727	0.761	GMP reductase 1
15	9606.ENSP00000379386	0.722	Lactate dehydrogenase B
16	9606.ENSP00000309539	0.710	Dihydropyrimidinase-related protein 2
17	9606.ENSP00000476535	0.686	annotation not available
18	9606.ENSP00000307214	0.680	tRNA wybutosine-synthesizing protein 4
19	9606.ENSP00000338413	0.680	Ubiquitin-like modifier-activating enzyme 1
20	9606.ENSP00000323099	0.674	ATR-interacting protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0008892	0.999	guanine deaminase activity
GO:0005515	0.954	protein binding
GO:0043167	0.625	ion binding
GO:0043169	0.527	cation binding
GO:0046872	0.522	metal ion binding
GO:0046914	0.486	transition metal ion binding
GO:0008270	0.442	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0006725	0.959	cellular aromatic compound metabolic process
GO:1901360	0.952	organic cyclic compound metabolic process
GO:0046483	0.944	heterocycle metabolic process
GO:0034641	0.931	cellular nitrogen compound metabolic process
GO:0006139	0.918	nucleobase-containing compound metabolic process
GO:0044281	0.700	small molecule metabolic process
GO:0050794	0.542	regulation of cellular process
GO:1901564	0.512	organonitrogen compound metabolic process
GO:0055086	0.480	nucleobase-containing small molecule metabolic process
GO:0072521	0.412	purine-containing compound metabolic process
GO:0032501	0.411	multicellular organismal process
GO:1901565	0.357	organonitrogen compound catabolic process
GO:0032502	0.347	developmental process
GO:0006753	0.340	nucleoside phosphate metabolic process
GO:0046700	0.330	heterocycle catabolic process
GO:0044270	0.324	cellular nitrogen compound catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.673	membrane-bounded organelle
GO:0043231	0.621	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14665	0.999	guanine + H(+) + H2O = NH4(+) + xanthine
EC:3.5.4.3	0.999	guanine deaminase.

[back to server]