StarFunc result for job id Q9Y2T4

User Input

>input (447 residues)
MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW
HPAENIIAIAATNNLYIFQDKVNSDMH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2T4	1.000	1.000	3.766E-88	447	1.000	1.000	Q9Y2T4.pdb.gz	2ABG_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R2C PE=1 SV=4
2	AFDB:P36877	0.979	0.988	5.736E-81	443	0.859	0.867	P36877.pdb.gz	2ABB_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2b PE=1 SV=2
3	AFDB:P56932	0.929	0.917	7.467E-74	453	0.801	0.790	P56932.pdb.gz	2ABD_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2d PE=2 SV=1
4	AFDB:A2BG80	0.932	0.930	2.241E-73	448	0.799	0.797	A2BG80.pdb.gz	A2BG80_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=MDS026 PE=1 SV=3
5	AFDB:X1WDS4	0.931	0.933	1.197E-69	446	0.725	0.726	X1WDS4.pdb.gz	X1WDS4_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=ppp2r2aa PE=1 SV=1
6	AFDB:P36872	0.913	0.819	2.915E-69	499	0.720	0.645	P36872.pdb.gz	2ABA_DROME Protein phosphatase PP2A 55 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=tws PE=2 SV=1
7	PDB:3dw8E	0.894	0.948	6.456E-68	421	0.781	0.829	3dw8E.pdb.gz	Structure of a protein phosphatase 2A holoenzyme: insights into B55-mediated Tau dephosphorylation.
8	AFDB:G5EDR3	0.898	0.813	4.211E-64	495	0.626	0.566	G5EDR3.pdb.gz	2AB1_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit sur-6 OS=Caenorhabditis elegans OX=6239 GN=sur-6 PE=1 SV=1
9	AFDB:C8VMY3	0.845	0.801	6.755E-59	472	0.553	0.523	C8VMY3.pdb.gz	C8VMY3_EMENI Protein phosphatase PP2A regulatory subunit B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01545 PE=3 SV=1
10	AFDB:Q39247	0.840	0.752	8.330E-58	501	0.523	0.467	Q39247.pdb.gz	2ABB_ARATH Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AB2 PE=1 SV=1
11	AFDB:Q54Q99	0.839	0.778	1.335E-56	483	0.506	0.468	Q54Q99.pdb.gz	PH2AB_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit phr2AB OS=Dictyostelium discoideum OX=44689 GN=phr2aB PE=3 SV=1
12	PDB:2h9lA	0.517	0.707	1.050E-14	321	0.172	0.240	2h9lA.pdb.gz
13	PDB:7vggA	0.509	0.732	1.969E-13	304	0.116	0.171	7vggA.pdb.gz
14	PDB:5nnzA	0.488	0.631	2.303E-13	335	0.143	0.191	5nnzA.pdb.gz
15	PDB:5o9zL	0.535	0.522	4.097E-13	459	0.114	0.111	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
16	PDB:5yzgs	0.525	0.620	4.097E-13	374	0.116	0.139	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
17	PDB:6bk8D	0.538	0.661	5.051E-13	359	0.128	0.159	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
18	PDB:5mqfF	0.545	0.772	6.227E-13	307	0.150	0.218	5mqfF.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
19	PDB:7r5jS0	0.527	0.712	6.227E-13	322	0.141	0.196	7r5jS0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:7mqaLO	0.432	0.248	6.914E-13	819	0.132	0.072	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2BG80	0.0	775	448	0.796	0.795	A2BG80_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=MDS026 PE=1 SV=3
2	G5EDR3	0.0	575	495	0.622	0.562	2AB1_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit sur-6 OS=Caenorhabditis elegans OX=6239 GN=sur-6 PE=1 SV=1
3	P36872	0.0	697	499	0.718	0.643	2ABA_DROME Protein phosphatase PP2A 55 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=tws PE=2 SV=1
4	P36876	0.0	777	447	0.803	0.803	2ABA_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2a PE=2 SV=1
5	P36877	0.0	833	443	0.859	0.867	2ABB_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2b PE=1 SV=2
6	P56932	0.0	773	453	0.799	0.788	2ABD_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2d PE=2 SV=1
7	P63151	0.0	776	447	0.801	0.801	2ABA_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R2A PE=1 SV=1
8	Q00005	0.0	835	443	0.864	0.871	2ABB_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Homo sapiens OX=9606 GN=PPP2R2B PE=1 SV=1
9	Q66LE6	0.0	781	453	0.805	0.795	2ABD_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Homo sapiens OX=9606 GN=PPP2R2D PE=1 SV=1
10	Q6IRD3	0.0	766	444	0.787	0.793	Q6IRD3_XENLA Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Xenopus laevis OX=8355 GN=ppp2r2a.S PE=1 SV=1
11	Q6NY64	0.0	784	447	0.817	0.817	2ABD_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Danio rerio OX=7955 GN=ppp2r2d PE=2 SV=1
12	Q6P1F6	0.0	776	447	0.801	0.801	2ABA_MOUSE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Mus musculus OX=10090 GN=Ppp2r2a PE=1 SV=1
13	Q6PGU9	0.0	769	448	0.794	0.792	Q6PGU9_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=ppp2r2d PE=1 SV=1
14	Q7ZX64	0.0	777	447	0.805	0.805	2ABD_XENLA Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Xenopus laevis OX=8355 GN=ppp2r2d PE=1 SV=1
15	Q9Y2T4	0.0	934	447	1.000	1.000	2ABG_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R2C PE=1 SV=4
16	X1WDS4	0.0	705	446	0.725	0.726	X1WDS4_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=ppp2r2aa PE=1 SV=1
17	C8VMY3	2.70e-169	486	472	0.548	0.519	C8VMY3_EMENI Protein phosphatase PP2A regulatory subunit B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01545 PE=3 SV=1
18	Q12702	2.78e-167	480	463	0.544	0.525	2ABA_SCHPO Protein phosphatase PP2A regulatory subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pab1 PE=1 SV=2
19	Q39247	1.86e-154	449	501	0.523	0.467	2ABB_ARATH Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AB2 PE=1 SV=1
20	Q54Q99	5.88e-153	444	483	0.512	0.474	PH2AB_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit phr2AB OS=Dictyostelium discoideum OX=44689 GN=phr2aB PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	9.3	17.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF00400 WD40	0.00018	33.4	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010368347.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010358250.1	0.999	Protein phosphatase 2 catalytic subunit alpha
2	61622.XP_010374830.1	0.998	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
3	61622.XP_010380628.1	0.998	Protein phosphatase 2 scaffold subunit Abeta
4	61622.XP_010378835.1	0.979	Chaperonin containing TCP1 subunit 6A
5	61622.XP_010354728.1	0.974	Chaperonin containing TCP1 subunit 3
6	61622.XP_010354983.1	0.974	Chaperonin containing TCP1 subunit 5
7	61622.XP_010357039.1	0.974	Chaperonin containing TCP1 subunit 2
8	61622.XP_010360266.1	0.974	Chaperonin containing TCP1 subunit 7
9	61622.XP_010363230.1	0.974	Chaperonin containing TCP1 subunit 8
10	61622.XP_010382746.1	0.974	Chaperonin containing TCP1 subunit 4
11	61622.XP_010369172.1	0.956	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
12	61622.XP_010381685.1	0.953	Belongs to the phosphatase 2A regulatory subunit B family.
13	61622.XP_010376443.1	0.930	Belongs to the phosphatase 2A regulatory subunit B family.
14	61622.XP_010358166.1	0.922	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform isoform X1
15	61622.XP_010359224.1	0.922	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides
16	61622.XP_010366799.1	0.921	T-complex 1
17	61622.XP_010379875.1	0.921	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
18	61622.XP_010385736.1	0.918	Serine/threonine-protein phosphatase 4 catalytic subunit
19	61622.XP_010360825.1	0.902	Leucine carboxyl methyltransferase 1 isoform X1
20	61622.XP_010364165.1	0.894	Serine/threonine-protein phosphatase 6 catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.616	molecular function regulator activity
GO:0019888	0.430	protein phosphatase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0048856	0.982	anatomical structure development
GO:0003158	0.967	endothelium development
GO:0032501	0.955	multicellular organismal process
GO:0048731	0.905	system development
GO:0002009	0.902	morphogenesis of an epithelium
GO:0001944	0.887	vasculature development
GO:0003159	0.883	morphogenesis of an endothelium
GO:0035295	0.881	tube development
GO:0065007	0.874	biological regulation
GO:0035239	0.836	tube morphogenesis
GO:0050794	0.825	regulation of cellular process
GO:0050896	0.818	response to stimulus
GO:0001568	0.814	blood vessel development
GO:0044237	0.811	cellular metabolic process
GO:0048514	0.773	blood vessel morphogenesis
GO:0071704	0.720	organic substance metabolic process
GO:0044238	0.702	primary metabolic process
GO:0043170	0.650	macromolecule metabolic process
GO:0061154	0.639	endothelial tube morphogenesis
GO:0006807	0.636	nitrogen compound metabolic process
GO:1901564	0.547	organonitrogen compound metabolic process
GO:0019538	0.499	protein metabolic process
GO:0043412	0.494	macromolecule modification
GO:0071840	0.478	cellular component organization or biogenesis
GO:0006796	0.469	phosphate-containing compound metabolic process
GO:0016043	0.436	cellular component organization
GO:0036211	0.431	protein modification process
GO:0019222	0.381	regulation of metabolic process
GO:0016311	0.338	dephosphorylation
GO:0031323	0.329	regulation of cellular metabolic process
GO:0080090	0.328	regulation of primary metabolic process
GO:0060255	0.317	regulation of macromolecule metabolic process
GO:0006470	0.314	protein dephosphorylation
GO:0051171	0.309	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0005634	0.996	nucleus
GO:0005829	0.982	cytosol
GO:0032991	0.981	protein-containing complex
GO:0005654	0.948	nucleoplasm
GO:1902494	0.926	catalytic complex
GO:0008287	0.857	protein serine/threonine phosphatase complex
GO:0045202	0.818	synapse
GO:0000159	0.749	protein phosphatase type 2A complex
GO:0016020	0.462	membrane
GO:0043232	0.350	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]