StarFunc result for job id Q9Y2U5

User Input

>input (619 residues)
MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFP
RPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLV
INGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARN
GSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQSY
PDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSLRSPVS
FSPTDHSLSTSSGSSIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGK
LLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQ
YYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIV
HRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR
KADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFVE
AKLRPSADELLRHMFVHYH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAH0	0.488	0.488	1.074E-96	619	1.000	1.000	A0A024RAH0.pdb.gz
2	AFDB:Q61084	0.535	0.529	1.251E-73	626	0.661	0.653	Q61084.pdb.gz	M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1
3	AFDB:Q389U2	0.408	0.417	9.256E-28	606	0.218	0.223	Q389U2.pdb.gz	Q389U2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0580 PE=4 SV=1
4	AFDB:Q9CAD5	0.381	0.270	1.170E-26	883	0.268	0.188	Q9CAD5.pdb.gz	YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1
5	AFDB:B7Z0W0	0.358	0.267	2.207E-20	840	0.210	0.155	B7Z0W0.pdb.gz	B7Z0W0_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Pak PE=4 SV=2
6	PDB:3eqdA	0.381	0.729	4.312E-19	315	0.134	0.263	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
7	AFDB:Q5B953	0.381	0.290	4.398E-18	828	0.205	0.153	Q5B953.pdb.gz	Q5B953_EMENI Checkpoint protein kinase, putative (AFU_orthologue AFUA_3G08100) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02927 PE=4 SV=1
8	PDB:6s73A	0.373	0.822	5.159E-18	269	0.131	0.301	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
9	AFDB:E1JGN0	0.370	0.206	6.470E-18	1141	0.184	0.100	E1JGN0.pdb.gz	E1JGN0_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
10	PDB:4d28C	0.355	0.748	1.643E-17	279	0.121	0.269	4d28C.pdb.gz
11	PDB:4c0tA	0.366	0.747	2.048E-17	291	0.118	0.251	4c0tA.pdb.gz
12	AFDB:Q9FPR3	0.388	0.262	2.060E-17	933	0.200	0.133	Q9FPR3.pdb.gz	EDR1_ARATH Serine/threonine-protein kinase EDR1 OS=Arabidopsis thaliana OX=3702 GN=EDR1 PE=1 SV=1
13	PDB:5ufuA	0.369	0.601	3.365E-17	369	0.128	0.214	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
14	PDB:7myjC	0.365	0.479	6.522E-17	465	0.123	0.163	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
15	PDB:4zhxA	0.369	0.544	1.071E-16	409	0.120	0.181	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
16	PDB:4mk0A	0.357	0.351	1.336E-16	631	0.110	0.108	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	PDB:6b1uA	0.369	0.507	1.576E-16	442	0.120	0.167	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
18	PDB:4rewA	0.359	0.529	1.666E-16	411	0.128	0.192	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	AFDB:Q4WVG0	0.366	0.210	7.849E-16	1106	0.157	0.088	Q4WVG0.pdb.gz	PKCA_ASPFU Protein kinase C OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=pkcA PE=1 SV=1
20	AFDB:J9W1R7	0.348	0.204	1.034E-15	1086	0.158	0.090	J9W1R7.pdb.gz	J9W1R7_CRYNH protein kinase C OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_01845 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M9D0	0.0	1240	619	0.961	0.961	F1M9D0_RAT Mitogen activated protein kinase kinase kinase 2 OS=Rattus norvegicus OX=10116 GN=Map3k2 PE=1 SV=2
2	Q61083	0.0	1219	619	0.958	0.958	M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus OX=10090 GN=Map3k2 PE=1 SV=2
3	Q61084	0.0	822	626	0.666	0.658	M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1
4	Q99759	0.0	820	626	0.662	0.655	M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2
5	Q9Y2U5	0.0	1285	619	1.000	1.000	M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2
6	X1WGZ3	0.0	782	620	0.646	0.645	X1WGZ3_DANRE Mitogen-activated protein kinase kinase kinase 3 OS=Danio rerio OX=7955 GN=map3k3 PE=4 SV=1
7	Q9FZ36	9.28e-80	266	651	0.220	0.209	M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1
8	O22040	1.64e-78	264	666	0.218	0.203	ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2
9	Q40541	1.60e-75	256	690	0.210	0.188	NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum OX=4097 GN=NPK1 PE=1 SV=1
10	O22042	1.72e-75	255	651	0.218	0.207	M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ANP3 PE=1 SV=1
11	F4HRJ4	1.31e-74	252	609	0.205	0.209	M3K3A_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK3 PE=1 SV=1
12	Q54R82	1.41e-69	244	942	0.197	0.130	MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2
13	Q9CAD5	1.92e-66	235	883	0.195	0.137	YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1
14	P28829	8.19e-65	227	659	0.191	0.179	BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=byr2 PE=1 SV=1
15	Q389U2	1.61e-64	225	606	0.195	0.200	Q389U2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0580 PE=4 SV=1
16	Q9C5H5	1.63e-63	224	716	0.189	0.163	M3K5G_ARATH Mitogen-activated protein kinase kinase kinase 5 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK5 PE=1 SV=1
17	Q6FXI1	2.01e-63	223	676	0.200	0.183	Q6FXI1_CANGA Candida glabrata strain CBS138 chromosome B complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=STE11 PE=3 SV=1
18	P23561	9.22e-63	222	717	0.204	0.176	STE11_YEAST Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STE11 PE=1 SV=3
19	G5EB26	2.09e-59	215	886	0.186	0.130	G5EB26_EMENI MAPKK kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02269 PE=3 SV=1
20	C8V9T1	1.04e-58	215	1558	0.200	0.080	C8V9T1_EMENI Mitogen-activated protein (MAP) kinase kinase kinase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04887 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.24	22.0	ABC1 atypical kinase-like domain
2	PF01636 APH	1.9e+02	13.3	Phosphotransferase enzyme family
3	PF13095 FTA2	94	14.1	Kinetochore Sim4 complex subunit FTA2
4	PF06293 Kdo	3.5e+02	12.0	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF14531 Kinase-like	0.15	23.0	Kinase-like
6	PF00564 PB1	1.4e-09	49.1	PB1 domain
7	PF00069 Pkinase	1.1e-62	223.4	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	7e-36	135.4	Protein tyrosine and serine/threonine kinase
9	PF07387 Seadorna_VP7	6.7e+02	10.7	Seadornavirus VP7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000019078

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000015873	0.996	Belongs to the protein kinase superfamily.
2	61853.ENSNLEP00000007631	0.928	Tyrosine-protein kinase
3	61853.ENSNLEP00000005010	0.920	CCM2 scaffolding protein
4	61853.ENSNLEP00000017716	0.919	Belongs to the protein kinase superfamily.
5	61853.ENSNLEP00000001997	0.903	P21 protein (Cdc42/Rac)-activated kinase 2
6	61853.ENSNLEP00000020301	0.903	P21 protein (Cdc42/Rac)-activated kinase 1
7	61853.ENSNLEP00000003153	0.887	Belongs to the protein kinase superfamily.
8	61853.ENSNLEP00000013924	0.863	Mitogen-activated protein kinase kinase kinase 4
9	61853.ENSNLEP00000002707	0.824	Mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
10	61853.ENSNLEP00000021805	0.824	TNF receptor-associated factor 6, E3 ubiquitin protein ligase
11	61853.ENSNLEP00000003720	0.818	Belongs to the protein kinase superfamily.
12	61853.ENSNLEP00000015688	0.813	Belongs to the protein kinase superfamily.
13	61853.ENSNLEP00000001468	0.790	Mitogen-activated protein kinase kinase 7
14	61853.ENSNLEP00000003166	0.783	Uncharacterized protein
15	61853.ENSNLEP00000006371	0.766	KRAS proto-oncogene, GTPase
16	61853.ENSNLEP00000010109	0.762	HRas proto-oncogene, GTPase
17	61853.ENSNLEP00000021483	0.762	Uncharacterized protein
18	61853.ENSNLEP00000005001	0.747	Uncharacterized protein
19	61853.ENSNLEP00000005003	0.747	Uncharacterized protein
20	61853.ENSNLEP00000015539	0.733	SH2 domain containing 2A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0019899	0.779	enzyme binding
GO:0019901	0.386	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0050896	0.953	response to stimulus
GO:0044237	0.880	cellular metabolic process
GO:0048583	0.843	regulation of response to stimulus
GO:0071704	0.819	organic substance metabolic process
GO:0007165	0.805	signal transduction
GO:0006468	0.803	protein phosphorylation
GO:0048518	0.801	positive regulation of biological process
GO:0035556	0.711	intracellular signal transduction
GO:0048522	0.703	positive regulation of cellular process
GO:0104004	0.700	cellular response to environmental stimulus
GO:0023051	0.499	regulation of signaling
GO:0010646	0.497	regulation of cell communication
GO:0009966	0.485	regulation of signal transduction
GO:0019222	0.479	regulation of metabolic process
GO:1902531	0.459	regulation of intracellular signal transduction
GO:0048519	0.367	negative regulation of biological process
GO:0060255	0.367	regulation of macromolecule metabolic process
GO:0048523	0.359	negative regulation of cellular process
GO:0032502	0.337	developmental process
GO:0006950	0.329	response to stress
GO:0032501	0.327	multicellular organismal process
GO:0048856	0.324	anatomical structure development
GO:0031323	0.324	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0031981	0.996	nuclear lumen
GO:0005654	0.994	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]