StarFunc result for job id Q9Y2U8

User Input

>input (911 residues)
MAAAAASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLKKLREEEQQQHRSGGRG
NKTRNSNNNNTAAATVAAAGPAAAAAAGMGVRPVSGDLSYLRTPGGLCRISASGPESLLG
GPGGASAAPAAGSKVLLGFSSDESDVEASPRDQAGGGGRKDRASLQYRGLKAPPAPLAAS
EVTNSNSAERRKPHSWWGARRPAGPELQTPPGKDGAVEDEEGEGEDGEERDPETEEPLWA
SRTVNGSRLVPYSCRENYSDSEEEDDDDVASSRQVLKDDSLSRHRPRRTHSKPLPPLTAK
SAGGRLETSVQGGGGLAMNDRAAAAGSLDRSRNLEEAAAAEQGGGCDQVDSSPVPRYRVN
AKKLTPLLPPPLTDMDSTLDSSTGSLLKTNNHIGGGAFSVDSPRIYSNSLPPSAAVAASS
SLRINHANHTGSNHTYLKNTYNKPKLSEPEEELLQQFKREEVSPTGSFSAHYLSMFLLTA
ACLFFLILGLTYLGMRGTGVSEDGELSIENPFGETFGKIQESEKTLMMNTLYKLHDRLAQ
LAGDHECGSSSQRTLSVQEAAAYLKDLGPEYEGIFNTSLQWILENGKDVGIRCVGFGPEE
ELTNITDVQFLQSTRPLMSFWCRFRRAFVTVTHRLLLLCLGVVMVCVVLRYMKYRWTKEE
EETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAV
DFLAANESRVRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRNSPPN
SLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLS
PEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTSNTPLKPSNKHMNSMSHLRL
RTGLTNSQGSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RBB9	0.436	0.436	0.000	911	1.000	1.000	A0A024RBB9.pdb.gz
2	AFDB:Q9WU40	0.595	0.589	0.000	921	0.846	0.837	Q9WU40.pdb.gz	MAN1_MOUSE Inner nuclear membrane protein Man1 OS=Mus musculus OX=10090 GN=Lemd3 PE=1 SV=2
3	AFDB:Q5TZH9	0.444	0.478	1.495E-68	841	0.497	0.539	Q5TZH9.pdb.gz	Q5TZH9_DANRE Inner nuclear membrane protein Man1 OS=Danio rerio OX=7955 GN=im:7158446 PE=1 SV=1
4	AFDB:Q54C61	0.145	0.141	7.274E-11	942	0.133	0.128	Q54C61.pdb.gz	Q54C61_DICDI Man1/Src1 C-terminal domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293138 PE=4 SV=1
5	PDB:6y5qq	0.088	0.427	4.134E-5	178	0.030	0.152	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
6	PDB:7evoD	0.090	0.385	1.307E-4	200	0.034	0.155	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
7	PDB:7c06A	0.097	0.371	2.661E-3	193	0.036	0.171	7c06A.pdb.gz	Elucidation of the aberrant 3' splice site selection by cancer-associated mutations on the U2AF1.
8	PDB:7oqcF	0.082	0.244	4.862E-3	267	0.024	0.082	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
9	PDB:3lqvB	0.086	0.563	6.054E-3	115	0.023	0.183	3lqvB.pdb.gz	Branch Recognition by SF3b14
10	PDB:3pgwP	0.093	0.588	6.054E-3	113	0.018	0.142	3pgwP.pdb.gz
11	PDB:6ff7X	0.091	0.432	6.755E-3	171	0.023	0.123	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
12	PDB:7r5jF0	0.086	0.282	6.755E-3	241	0.019	0.071	7r5jF0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	PDB:6lurD	0.084	0.317	7.537E-3	213	0.022	0.094	6lurD.pdb.gz	Revisiting biomolecular NMR spectroscopy for promoting small-molecule drug discovery.
14	PDB:5v8f8	0.091	0.149	1.377E-2	519	0.024	0.042	5v8f8.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
15	AFDB:Q5RGX4	0.053	0.064	3.345E-2	685	0.093	0.124	Q5RGX4.pdb.gz	Q5RGX4_DANRE Thymopoietin a OS=Danio rerio OX=7955 GN=LAP2 PE=1 SV=1
16	AFDB:Q7ZTV0	0.043	0.060	7.609E-2	657	0.108	0.149	Q7ZTV0.pdb.gz	Q7ZTV0_DANRE Thymopoietin OS=Danio rerio OX=7955 GN=tmpo PE=1 SV=1
17	AFDB:Q9W3Q5	0.065	0.049	8.038E-2	1268	0.100	0.072	Q9W3Q5.pdb.gz	Q9W3Q5_DROME Checkpoint suppressor 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=4 SV=4
18	AFDB:Q7TSH4	0.053	0.050	2.683E-1	1004	0.120	0.109	Q7TSH4.pdb.gz	CP110_MOUSE Centriolar coiled-coil protein of 110 kDa OS=Mus musculus OX=10090 GN=Ccp110 PE=1 SV=1
19	AFDB:Q3UJB9	0.059	0.044	7.601E-1	1406	0.120	0.078	Q3UJB9.pdb.gz	EDC4_MOUSE Enhancer of mRNA-decapping protein 4 OS=Mus musculus OX=10090 GN=Edc4 PE=1 SV=2
20	AFDB:X1WEA3	0.046	0.042	8.959E-1	1034	0.116	0.103	X1WEA3.pdb.gz	X1WEA3_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=ulk2 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TZH9	0.0	721	841	0.503	0.545	Q5TZH9_DANRE Inner nuclear membrane protein Man1 OS=Danio rerio OX=7955 GN=im:7158446 PE=1 SV=1
2	Q9WU40	0.0	1358	921	0.829	0.820	MAN1_MOUSE Inner nuclear membrane protein Man1 OS=Mus musculus OX=10090 GN=Lemd3 PE=1 SV=2
3	Q9Y2U8	0.0	1889	911	1.000	1.000	MAN1_HUMAN Inner nuclear membrane protein Man1 OS=Homo sapiens OX=9606 GN=LEMD3 PE=1 SV=2
4	Q6DVA0	1.49e-52	194	511	0.115	0.205	LEMD2_MOUSE LEM domain-containing protein 2 OS=Mus musculus OX=10090 GN=Lemd2 PE=1 SV=1
5	Q8NC56	2.50e-50	187	503	0.108	0.195	LEMD2_HUMAN LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LEMD2 PE=1 SV=1
6	Q7JRE4	6.88e-26	116	650	0.156	0.218	MAN1_DROME Inner nuclear membrane protein Man1 OS=Drosophila melanogaster OX=7227 GN=MAN1 PE=1 SV=1
7	A0A384NQ03	2.78e-22	104	530	0.052	0.089	A0A384NQ03_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
8	Q14498	2.78e-22	104	530	0.052	0.089	RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2
9	Q8VH51	2.86e-22	103	530	0.052	0.089	RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus OX=10090 GN=Rbm39 PE=1 SV=2
10	Q9VM49	6.41e-20	97.1	594	0.047	0.072	Q9VM49_DROME Caper, isoform A OS=Drosophila melanogaster OX=7227 GN=Caper PE=1 SV=1
11	F4ILE1	5.10e-15	81.6	610	0.043	0.064	F4ILE1_ARATH Splicing factor, CC1-like protein OS=Arabidopsis thaliana OX=3702 GN=At2g16940 PE=1 SV=1
12	Q9XTB5	3.39e-11	68.9	500	0.043	0.078	LEM2_CAEEL LEM protein 2 OS=Caenorhabditis elegans OX=6239 GN=lem-2 PE=1 SV=1
13	O13845	2.61e-10	66.6	603	0.036	0.055	RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsd1 PE=1 SV=2
14	Q03707	0.002	44.3	834	0.027	0.030	SRC1_YEAST Inner nuclear membrane protein SRC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRC1 PE=1 SV=2
15	O01971	0.038	38.5	166	0.020	0.108	EMR1_CAEEL Emerin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=emr-1 PE=1 SV=1
16	Q68G75	0.046	38.5	181	0.021	0.105	LEMD1_HUMAN LEM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LEMD1 PE=1 SV=2
17	Q5RGX2	0.067	38.9	369	0.021	0.051	Q5RGX2_DANRE Thymopoietin a OS=Danio rerio OX=7955 GN=LAP2 PE=1 SV=1
18	Q5RGX5	0.078	38.9	515	0.021	0.037	Q5RGX5_DANRE Thymopoietin a OS=Danio rerio OX=7955 GN=LAP2 PE=1 SV=1
19	Q5RGX4	0.092	38.9	685	0.021	0.028	Q5RGX4_DANRE Thymopoietin a OS=Danio rerio OX=7955 GN=LAP2 PE=1 SV=1
20	Q7ZTV0	0.098	38.9	657	0.021	0.029	Q7ZTV0_DANRE Thymopoietin OS=Danio rerio OX=7955 GN=tmpo PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03020 LEM	1.1e-14	65.1	LEM domain
2	PF09402 MSC	3.8e-16	71.1	Man1-Src1p-C-terminal domain
3	PF15519 RBM39linker	37	16.6	linker between RRM2 and RRM3 domains in RBM39 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308369

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310275	0.998	Barrier-to-autointegration factor
2	9606.ENSP00000261366	0.997	Lamin-B1
3	9606.ENSP00000357283	0.996	Prelamin-A/C
4	9606.ENSP00000262160	0.993	Mothers against decapentaplegic homolog 2
5	9606.ENSP00000216639	0.959	Serine/threonine-protein kinase VRK1
6	9606.ENSP00000408002	0.937	Serine/threonine-protein kinase VRK2
7	9606.ENSP00000327054	0.930	Lamin-B2
8	9606.ENSP00000426568	0.929	Mothers against decapentaplegic homolog 1
9	9606.ENSP00000358857	0.921	Emerin
10	9606.ENSP00000350263	0.910	GPI ethanolamine phosphate transferase 1
11	9606.ENSP00000305355	0.909	Protein kinase C beta type
12	9606.ENSP00000408695	0.906	Protein kinase C alpha type
13	9606.ENSP00000332973	0.895	Mothers against decapentaplegic homolog 3
14	9606.ENSP00000369154	0.881	Mothers against decapentaplegic homolog 9
15	9606.ENSP00000350686	0.877	Ankyrin repeat and LEM domain-containing protein 2
16	9606.ENSP00000339883	0.871	Lamin-B receptor
17	9606.ENSP00000286574	0.820	Wnt inhibitory factor 1
18	9606.ENSP00000377971	0.775	Ankyrin repeat and LEM domain-containing protein 1
19	9606.ENSP00000360532	0.762	Cell division cycle 5-like protein
20	9606.ENSP00000267812	0.752	Microfibrillar-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0048519	0.965	negative regulation of biological process
GO:0090092	0.959	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0090287	0.958	regulation of cellular response to growth factor stimulus
GO:0048523	0.955	negative regulation of cellular process
GO:0009987	0.883	cellular process
GO:0090101	0.859	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:1903844	0.810	regulation of cellular response to transforming growth factor beta stimulus
GO:0071840	0.634	cellular component organization or biogenesis
GO:0032925	0.604	regulation of activin receptor signaling pathway
GO:0016043	0.598	cellular component organization
GO:0030510	0.596	regulation of BMP signaling pathway
GO:0017015	0.553	regulation of transforming growth factor beta receptor signaling pathway
GO:0090288	0.542	negative regulation of cellular response to growth factor stimulus
GO:0006996	0.458	organelle organization
GO:0030514	0.384	negative regulation of BMP signaling pathway
GO:0006997	0.373	nucleus organization
GO:0030512	0.330	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0048856	0.305	anatomical structure development
GO:0032501	0.301	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005635	1.000	nuclear envelope
GO:0031090	0.998	organelle membrane
GO:0031965	0.993	nuclear membrane
GO:0070013	0.861	intracellular organelle lumen
GO:0005737	0.663	cytoplasm
GO:0031981	0.582	nuclear lumen
GO:0019866	0.419	organelle inner membrane
GO:0005637	0.356	nuclear inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]