StarFunc result for job id Q9Y2V3

User Input

>input (346 residues)
MHLPGCAPAMADGSFSLAGHLLRSPGGSTSRLHSIEAILGFTKDDGILGTFPAERGARGA
KERDRRLGARPACPKAPEEGSEPSPPPAPAPAPEYEAPRPYCPKEPGEARPSPGLPVGPA
TGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRV
QVWFQNRRAKWRRQEKLEVSSMKLQDSPLLSFSRSPPSATLSPLGAGPGSGGGPAGGALP
LESWLGPPLPGGGATALQSLPGFGPPAQSLPASYTPPPPPPPFLNSPPLGPGLQPLAPPP
PSYPCGPGFGDKFPLDEADPRNSSIAALRLKAKEHIQAIGKPWQAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2V3	0.999	0.999	1.188E-49	346	1.000	1.000	Q9Y2V3.pdb.gz	RX_HUMAN Retinal homeobox protein Rx OS=Homo sapiens OX=9606 GN=RAX PE=1 SV=2
2	AFDB:O35602	0.347	0.351	1.700E-38	342	0.864	0.874	O35602.pdb.gz	RX_MOUSE Retinal homeobox protein Rx OS=Mus musculus OX=10090 GN=Rax PE=2 SV=2
3	AFDB:O42356	0.268	0.280	3.496E-22	330	0.474	0.497	O42356.pdb.gz	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
4	AFDB:O42357	0.349	0.368	5.983E-21	327	0.468	0.495	O42357.pdb.gz	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
5	AFDB:O09113	0.215	0.228	2.070E-10	325	0.292	0.311	O09113.pdb.gz	OTP_MOUSE Homeobox protein orthopedia OS=Mus musculus OX=10090 GN=Otp PE=2 SV=1
6	AFDB:Q15699	0.262	0.276	2.208E-10	326	0.266	0.282	Q15699.pdb.gz	ALX1_HUMAN ALX homeobox protein 1 OS=Homo sapiens OX=9606 GN=ALX1 PE=1 SV=2
7	AFDB:Q1LVQ7	0.307	0.328	3.049E-10	320	0.260	0.281	Q1LVQ7.pdb.gz	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1
8	AFDB:B0S5T0	0.236	0.281	5.814E-10	285	0.257	0.312	B0S5T0.pdb.gz	B0S5T0_DANRE Short stature homeobox OS=Danio rerio OX=7955 GN=si:ch211-134k13.1 PE=4 SV=1
9	AFDB:P54821	0.274	0.376	5.814E-10	245	0.251	0.355	P54821.pdb.gz	PRRX1_HUMAN Paired mesoderm homeobox protein 1 OS=Homo sapiens OX=9606 GN=PRRX1 PE=1 SV=2
10	AFDB:Q6QU75	0.260	0.301	1.982E-9	293	0.246	0.290	Q6QU75.pdb.gz	PITX3_DANRE Pituitary homeobox 3 OS=Danio rerio OX=7955 GN=pitx3 PE=2 SV=1
11	PDB:4egcA	0.147	0.094	2.264E-2	539	0.043	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.144	0.612	4.604E-2	73	0.058	0.274	2hi3A.pdb.gz
13	PDB:7fbyA	0.111	0.229	5.348E-1	153	0.032	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5aj0BZ	0.112	0.326	1.502	86	0.017	0.070	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:5mrca	0.099	0.176	2.212	177	0.043	0.085	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
16	PDB:4ldzA	0.141	0.237	3.259	196	0.020	0.036	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
17	PDB:7b93E	0.082	0.126	3.259	215	0.029	0.047	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
18	PDB:2rvqD	0.084	0.180	3.476	129	0.040	0.109	2rvqD.pdb.gz
19	PDB:2y75E	0.083	0.182	4.219	129	0.029	0.078	2y75E.pdb.gz
20	PDB:5fywR	0.103	0.172	4.219	199	0.026	0.045	5fywR.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35602	0.0	533	342	0.864	0.874	RX_MOUSE Retinal homeobox protein Rx OS=Mus musculus OX=10090 GN=Rax PE=2 SV=2
2	Q9Y2V3	0.0	675	346	1.000	1.000	RX_HUMAN Retinal homeobox protein Rx OS=Homo sapiens OX=9606 GN=RAX PE=1 SV=2
3	O42357	1.17e-87	268	327	0.468	0.495	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
4	O42358	2.38e-87	266	292	0.506	0.599	RX3_DANRE Retinal homeobox protein Rx3 OS=Danio rerio OX=7955 GN=rx3 PE=2 SV=1
5	O42356	2.22e-81	252	330	0.480	0.503	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
6	Q96IS3	2.87e-48	162	184	0.312	0.587	RAX2_HUMAN Retina and anterior neural fold homeobox protein 2 OS=Homo sapiens OX=9606 GN=RAX2 PE=1 SV=1
7	Q9H161	5.08e-31	123	411	0.251	0.212	ALX4_HUMAN Homeobox protein aristaless-like 4 OS=Homo sapiens OX=9606 GN=ALX4 PE=1 SV=2
8	O35137	7.36e-31	122	399	0.246	0.213	ALX4_MOUSE Homeobox protein aristaless-like 4 OS=Mus musculus OX=10090 GN=Alx4 PE=1 SV=1
9	Q94398	3.94e-30	118	276	0.150	0.188	HM08_CAEEL Homeobox protein ceh-8 OS=Caenorhabditis elegans OX=6239 GN=ceh-8 PE=1 SV=3
10	Q8C8B0	3.52e-29	116	326	0.225	0.239	ALX1_MOUSE ALX homeobox protein 1 OS=Mus musculus OX=10090 GN=Alx1 PE=1 SV=1
11	Q15699	5.19e-29	116	326	0.225	0.239	ALX1_HUMAN ALX homeobox protein 1 OS=Homo sapiens OX=9606 GN=ALX1 PE=1 SV=2
12	V9HWA7	5.19e-29	116	326	0.225	0.239	V9HWA7_HUMAN Cartilage paired-class homeoprotein 1 OS=Homo sapiens OX=9606 GN=HEL23 PE=2 SV=1
13	Q63087	1.25e-28	115	326	0.225	0.239	ALX1_RAT ALX homeobox protein 1 OS=Rattus norvegicus OX=10116 GN=Alx1 PE=1 SV=1
14	Q06453	3.12e-28	115	408	0.136	0.115	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2
15	O42115	3.13e-28	116	453	0.145	0.110	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
16	Q8T0V5	3.31e-28	114	357	0.156	0.151	Q8T0V5_DROME GH01528p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
17	Q9XZU0	3.55e-28	114	357	0.156	0.151	Q9XZU0_DROME FI01102p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
18	Q1LVQ7	3.97e-28	113	320	0.220	0.237	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1
19	A6YP92	1.08e-27	115	566	0.145	0.088	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
20	Q96QS3	1.37e-27	115	562	0.145	0.089	ARX_HUMAN Homeobox protein ARX OS=Homo sapiens OX=9606 GN=ARX PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	3.1e+02	12.7	Homeobox KN domain
2	PF00046 Homeodomain	2.3e-20	83.5	Homeodomain
3	PF03826 OAR	2.8e-06	38.2	OAR motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334813

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260653	0.791	Homeobox protein SIX3
2	9606.ENSP00000328596	0.745	Homeobox protein SIX6
3	9606.ENSP00000360329	0.720	Tetratricopeptide repeat domain containing
4	9606.ENSP00000362777	0.656	Protein atonal homolog 7
5	9606.ENSP00000323588	0.577	Transcription factor SOX-2
6	9606.ENSP00000227322	0.549	Zinc finger protein ZPR1
7	9606.ENSP00000221665	0.546	Flt3-interacting zinc finger protein 1
8	9606.ENSP00000295108	0.529	Neurogenic differentiation factor 1
9	9606.ENSP00000370639	0.529	Acetylserotonin O-methyltransferase
10	9606.ENSP00000404100	0.515	Paired box protein Pax-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.989	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0005515	0.950	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.989	multicellular organismal process
GO:0050794	0.985	regulation of cellular process
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:0050953	0.920	sensory perception of light stimulus
GO:0010468	0.916	regulation of gene expression
GO:0051171	0.901	regulation of nitrogen compound metabolic process
GO:0080090	0.890	regulation of primary metabolic process
GO:0031326	0.880	regulation of cellular biosynthetic process
GO:0019219	0.879	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.871	regulation of DNA-templated transcription
GO:0048518	0.862	positive regulation of biological process
GO:0045893	0.838	positive regulation of DNA-templated transcription
GO:0009987	0.798	cellular process
GO:0048856	0.793	anatomical structure development
GO:0007601	0.729	visual perception
GO:0006357	0.718	regulation of transcription by RNA polymerase II
GO:0048513	0.703	animal organ development
GO:0007275	0.672	multicellular organism development
GO:0045944	0.657	positive regulation of transcription by RNA polymerase II
GO:0048731	0.654	system development
GO:0007399	0.493	nervous system development
GO:0050896	0.438	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.979	intracellular organelle lumen
GO:0031981	0.947	nuclear lumen
GO:0005654	0.900	nucleoplasm
GO:0005737	0.705	cytoplasm
GO:0043232	0.373	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]