StarFunc result for job id Q9Y2W1

User Input

>input (955 residues)
MSKTNKSKSGSRSSRSRSASRSRSRSFSKSRSRSRSLSRSRKRRLSSRSRSRSYSPAHNR
ERNHPRVYQNRDFRGHNRGYRRPYYFRGRNRGFYPWGQYNRGGYGNYRSNWQNYRQAYSP
RRGRSRSRSPKRRSPSPRSRSHSRNSDKSSSDRSRRSSSSRSSSNHSRVESSKRKSAKEK
KSSSKDSRPSQAAGDNQGDEAKEQTFSGGTSQDTKASESSKPWPDATYGTGSASRASAVS
ELSPRERSPALKSPLQSVVVRRRSPRPSPVPKPSPPLSSTSQMGSTLPSGAGYQSGTHQG
QFDHGSGSLSPSKKSPVGKSPPSTGSTYGSSQKEESAASGGAAYTKRYLEEQKTENGKDK
EQKQTNTDKEKIKEKGSFSDTGLGDGKMKSDSFAPKTDSEKPFRGSQSPKRYKLRDDFEK
KMADFHKEEMDDQDKDKAKGRKESEFDDEPKFMSKVIGANKNQEEEKSGKWEGLVYAPPG
KEKQRKTEELEEESFPERSKKEDRGKRSEGGHRGFVPEKNFRVTAYKAVQEKSSSPPPRK
TSESRDKLGAKGDFPTGKSSFSITREAQVNVRMDSFDEDLARPSGLLAQERKLCRDLVHS
NKKEQEFRSIFQHIQSAQSQRSPSELFAQHIVTIVHHVKEHHFGSSGMTLHERFTKYLKR
GTEQEAAKNKKSPEIHRRIDISPSTFRKHGLAHDEMKSPREPGYKAEGKYKDDPVDLRLD
IERRKKHKERDLKRGKSRESVDSRDSSHSRERSAEKTEKTHKGSKKQKKHRRARDRSRSS
SSSSQSSHSYKAEEYTEETEEREESTTGFDKSRLGTKDFVGPSERGGGRARGTFQFRARG
RGWGRGNYSGNNNNNSNNDFQKRNREEEWDPEYTPKSKKYYLHDDREGEGSDKWVSRGRG
RGAFPRGRGRFMFRKSSTSPKWAHDKFSGEEGEIEDDESGTENREEKDNIQPTTE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2W1	1.000	1.000	0.000	955	1.000	1.000	Q9Y2W1.pdb.gz	TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2
2	AFDB:Q9NYF8	0.093	0.095	2.399E-36	920	0.396	0.411	Q9NYF8.pdb.gz	BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2
3	AFDB:Q9VI93	0.057	0.058	8.435E-6	946	0.119	0.121	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
4	AFDB:Q9VFH4	0.054	0.046	1.107E-5	1200	0.128	0.102	Q9VFH4.pdb.gz	Q9VFH4_DROME LD12755p OS=Drosophila melanogaster OX=7227 GN=l(3)L1231 PE=2 SV=1
5	AFDB:Q14151	0.058	0.058	4.612E-5	953	0.138	0.139	Q14151.pdb.gz	SAFB2_HUMAN Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1
6	AFDB:Q8L7W3	0.058	0.062	5.656E-5	878	0.164	0.179	Q8L7W3.pdb.gz	Q8L7W3_ARATH At2g29210/F16P2.41 OS=Arabidopsis thaliana OX=3702 GN=At2g29210 PE=1 SV=1
7	AFDB:Q9C0I3	0.047	0.047	7.944E-5	900	0.131	0.139	Q9C0I3.pdb.gz	CCSE1_HUMAN Serine-rich coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CCSER1 PE=1 SV=2
8	AFDB:A1Z9W4	0.036	0.026	9.101E-5	1953	0.146	0.071	A1Z9W4.pdb.gz	A1Z9W4_DROME LD11480p OS=Drosophila melanogaster OX=7227 GN=Pcf11 PE=1 SV=2
9	AFDB:Q8IHQ2	0.049	0.039	1.922E-4	1301	0.113	0.083	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
10	AFDB:Q08921	0.054	0.063	2.522E-4	799	0.121	0.145	Q08921.pdb.gz	TCO89_YEAST Target of rapamycin complex 1 subunit TCO89 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TCO89 PE=1 SV=1
11	PDB:7mqaSS	0.040	0.087	7.852E-1	350	0.035	0.094	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7edxH	0.030	0.102	3.057	209	0.026	0.120	7edxH.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:6yy0d	0.034	0.127	6.031	156	0.021	0.128	6yy0d.pdb.gz	Structure of the dimeric ATP synthase from bovine mitochondria.
14	PDB:6mzcM	0.039	0.197	6.455	104	0.017	0.154	6mzcM.pdb.gz
15	PDB:6hivCv	0.034	0.031	7.395	1059	0.020	0.018	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
16	PDB:7mq8LL	0.044	0.073	7.915	510	0.019	0.035	7mq8LL.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:3h0gD	0.042	0.206	9.067	130	0.006	0.046	3h0gD.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
18	PDB:6v8oO	0.032	0.070	9.067	384	0.024	0.060	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
19	PDB:7mq8SS	0.032	0.121	9.067	197	0.024	0.117	7mq8SS.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:5mqfK	0.052	0.181	9.704	191	0.014	0.068	5mqfK.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3ITZ9	0.0	1783	910	0.936	0.982	A0A3B3ITZ9_HUMAN Thyroid hormone receptor associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=1
2	Q569Z6	0.0	1342	951	0.874	0.878	TR150_MOUSE Thyroid hormone receptor-associated protein 3 OS=Mus musculus OX=10090 GN=Thrap3 PE=1 SV=1
3	Q9Y2W1	0.0	1909	955	1.000	1.000	TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2
4	Q8K019	2.33e-76	271	919	0.271	0.282	BCLF1_MOUSE Bcl-2-associated transcription factor 1 OS=Mus musculus OX=10090 GN=Bclaf1 PE=1 SV=2
5	Q9NYF8	7.86e-72	258	920	0.203	0.211	BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2
6	E9PK91	3.12e-38	156	871	0.158	0.173	E9PK91_HUMAN BCL2 associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=1
7	E9PKI6	1.48e-35	147	752	0.090	0.114	E9PKI6_HUMAN BCL2 associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=1
8	E9PK09	1.28e-33	141	725	0.089	0.117	E9PK09_HUMAN BCL2 associated transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=8

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15440 THRAP3_BCLAF1	5.2e-201	681.8	THRAP3/BCLAF1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346634

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300651	0.958	Mediator of RNA polymerase II transcription subunit 1
2	9606.ENSP00000435210	0.950	Bcl-2-associated transcription factor 1
3	9606.ENSP00000325612	0.935	Mediator of RNA polymerase II transcription subunit 16
4	9606.ENSP00000323720	0.933	Mediator of RNA polymerase II transcription subunit 14
5	9606.ENSP00000370938	0.929	Cyclin-dependent kinase 8
6	9606.ENSP00000363193	0.917	Mediator of RNA polymerase II transcription subunit 12
7	9606.ENSP00000258648	0.912	Mediator of RNA polymerase II transcription subunit 4
8	9606.ENSP00000481920	0.911	Mediator of RNA polymerase II transcription subunit 6
9	9606.ENSP00000389814	0.910	Adiponectin
10	9606.ENSP00000251871	0.908	Mediator of RNA polymerase II transcription subunit 17
11	9606.ENSP00000296215	0.908	Smad nuclear-interacting protein 1
12	9606.ENSP00000297347	0.908	Mediator of RNA polymerase II transcription subunit 30
13	9606.ENSP00000256104	0.903	Fatty acid-binding protein, adipocyte
14	9606.ENSP00000293777	0.903	Mediator of RNA polymerase II transcription subunit 11
15	9606.ENSP00000427514	0.903	CCAAT/enhancer-binding protein alpha
16	9606.ENSP00000482438	0.903	Mediator of RNA polymerase II transcription subunit 22
17	9606.ENSP00000263390	0.902	Mediator of RNA polymerase II transcription subunit 26
18	9606.ENSP00000362948	0.902	Mediator of RNA polymerase II transcription subunit 18
19	9606.ENSP00000380888	0.902	Mediator of RNA polymerase II transcription subunit 13
20	9606.ENSP00000282892	0.900	Mediator of RNA polymerase II transcription subunit 21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0003723	1.000	RNA binding
GO:0016922	0.995	nuclear receptor binding
GO:0046966	0.993	nuclear thyroid hormone receptor binding
GO:0051219	0.988	phosphoprotein binding
GO:0003677	0.771	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006807	0.992	nitrogen compound metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:0050789	0.986	regulation of biological process
GO:1901360	0.986	organic cyclic compound metabolic process
GO:0050794	0.984	regulation of cellular process
GO:0090304	0.979	nucleic acid metabolic process
GO:0019222	0.977	regulation of metabolic process
GO:0080090	0.973	regulation of primary metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0031323	0.973	regulation of cellular metabolic process
GO:0010468	0.973	regulation of gene expression
GO:0016070	0.973	RNA metabolic process
GO:0048518	0.955	positive regulation of biological process
GO:0051252	0.947	regulation of RNA metabolic process
GO:0048522	0.945	positive regulation of cellular process
GO:0009889	0.929	regulation of biosynthetic process
GO:0010556	0.918	regulation of macromolecule biosynthetic process
GO:0031326	0.918	regulation of cellular biosynthetic process
GO:0016071	0.911	mRNA metabolic process
GO:0010604	0.898	positive regulation of macromolecule metabolic process
GO:0048519	0.890	negative regulation of biological process
GO:0051254	0.889	positive regulation of RNA metabolic process
GO:0006355	0.885	regulation of DNA-templated transcription
GO:0010557	0.883	positive regulation of macromolecule biosynthetic process
GO:0031328	0.883	positive regulation of cellular biosynthetic process
GO:0048523	0.879	negative regulation of cellular process
GO:1903508	0.845	positive regulation of nucleic acid-templated transcription
GO:0045893	0.843	positive regulation of DNA-templated transcription
GO:0010605	0.752	negative regulation of macromolecule metabolic process
GO:0031324	0.677	negative regulation of cellular metabolic process
GO:0051172	0.674	negative regulation of nitrogen compound metabolic process
GO:0010467	0.668	gene expression
GO:0006357	0.561	regulation of transcription by RNA polymerase II
GO:0045934	0.454	negative regulation of nucleobase-containing compound metabolic process
GO:0050896	0.430	response to stimulus
GO:0051253	0.423	negative regulation of RNA metabolic process
GO:0043484	0.343	regulation of RNA splicing
GO:1903311	0.341	regulation of mRNA metabolic process
GO:0050684	0.328	regulation of mRNA processing
GO:0048024	0.314	regulation of mRNA splicing, via spliceosome
GO:0010628	0.311	positive regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.992	protein-containing complex
GO:0016604	0.981	nuclear body
GO:0016607	0.950	nuclear speck
GO:0140513	0.943	nuclear protein-containing complex
GO:0005576	0.708	extracellular region
GO:0031982	0.624	vesicle
GO:1903561	0.601	extracellular vesicle
GO:0005615	0.597	extracellular space
GO:0070062	0.593	extracellular exosome
GO:0016592	0.588	mediator complex
GO:0005737	0.407	cytoplasm
GO:0035145	0.380	exon-exon junction complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]