StarFunc result for job id Q9Y2X0

User Input

>input (877 residues)
MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTR
MIHILDTEHPWDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSMADHLANSWES
SVGSLVEGDPIVALSWLHNGVKLALHVEKSGASSFGEKFSRVKFSPSLTLFGGKPMEGWI
AVTVSGLVTVSLLKPSGQVLTSTESLCRLRGRVALADIAFTGGGNIVVATADGSSASPVQ
FYKVCVSVVSEKCRIDTEILPSLFMRCTTDLNRKDKFPAITHLKFLARDMSEQVLLCASS
QTSSIVECWSLRKEGLPVNNIFQQISPVVGDKQPTILKWRILSATNDLDRVSAVALPKLP
ISLTNTDLKVASDTQFYPGLGLALAFHDGSVHIVHRLSLQTMAVFYSSAAPRPVDEPAMK
RPRTAGPAVHLKAMQLSWTSLALVGIDSHGKLSVLRLSPSMGHPLEVGLALRHLLFLLEY
CMVTGYDWWDILLHVQPSMVQSLVEKLHEEYTRQTAALQQVLSTRILAMKASLCKLSPCT
VTRVCDYHTKLFLIAISSTLKSLLRPHFLNTPDKSPGDRLTEICTKITDVDIDKVMINLK
TEEFVLDMNTLQALQQLLQWVGDFVLYLLASLPNQGSLLRPGHSFLRDGTSLGMLRELMV
VIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICCRDEGPASEPDEALVDECCLL
PSQLLIPSLDWLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLDGLARAPGQPKID
HLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCLAVEGRGPDACVT
SRASEEAPAFVQLGPQSTHHSPRTPRSLDHLHPEDRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7emfP	0.829	0.946	0.000	766	0.853	0.977	7emfP.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
2	AFDB:Q9Y2X0	1.000	1.000	0.000	877	1.000	1.000	Q9Y2X0.pdb.gz	MED16_HUMAN Mediator of RNA polymerase II transcription subunit 16 OS=Homo sapiens OX=9606 GN=MED16 PE=1 SV=2
3	PDB:6w1sK	0.698	0.821	1.759E-55	735	0.712	0.849	6w1sK.pdb.gz	A Pliable Mediator Acts as a Functional Rather Than an Architectural Bridge between Promoters and Enhancers.
4	AFDB:Q9W278	0.773	0.827	1.978E-52	818	0.265	0.284	Q9W278.pdb.gz	MED16_DROME Mediator of RNA polymerase II transcription subunit 16 OS=Drosophila melanogaster OX=7227 GN=MED16 PE=1 SV=2
5	AFDB:F4JGZ1	0.620	0.442	1.578E-21	1278	0.184	0.126	F4JGZ1.pdb.gz	MED16_ARATH Mediator of RNA polymerase II transcription subunit 16 OS=Arabidopsis thaliana OX=3702 GN=MED16 PE=1 SV=1
6	PDB:6tblF	0.272	0.635	7.120E-11	336	0.062	0.161	6tblF.pdb.gz
7	AFDB:B5DFJ4	0.267	0.244	7.395E-11	973	0.097	0.087	B5DFJ4.pdb.gz	B5DFJ4_RAT Vacuolar protein sorting-associated protein 18 homolog OS=Rattus norvegicus OX=10116 GN=Vps18 PE=1 SV=1
8	AFDB:Q9P7N3	0.259	0.261	1.761E-10	871	0.101	0.102	Q9P7N3.pdb.gz	VPS41_SCHPO Vacuolar protein sorting-associated protein 41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps41 PE=3 SV=2
9	AFDB:Q9LJR3	0.277	0.286	2.316E-10	845	0.055	0.057	Q9LJR3.pdb.gz	SPA3_ARATH Protein SPA1-RELATED 3 OS=Arabidopsis thaliana OX=3702 GN=SPA3 PE=1 SV=1
10	AFDB:P43254	0.283	0.360	2.538E-10	675	0.058	0.076	P43254.pdb.gz	COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana OX=3702 GN=COP1 PE=1 SV=2
11	PDB:8gqeA	0.274	0.626	3.070E-10	348	0.063	0.158	8gqeA.pdb.gz
12	AFDB:Q5U3Q5	0.266	0.260	3.338E-10	897	0.081	0.079	Q5U3Q5.pdb.gz	Q5U3Q5_DANRE Transducin beta-like protein 3 OS=Danio rerio OX=7955 GN=zgc:101778 PE=1 SV=1
13	AFDB:F1RAC4	0.150	0.143	4.194E-10	937	0.082	0.077	F1RAC4.pdb.gz
14	AFDB:O45087	0.311	0.410	4.390E-10	643	0.072	0.098	O45087.pdb.gz	O45087_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dyci-1 PE=1 SV=1
15	PDB:7mqaLQ	0.109	0.113	4.425E-10	830	0.101	0.107	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7mq8LR	0.248	0.278	7.312E-10	773	0.057	0.065	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7vggA	0.266	0.696	8.778E-10	304	0.057	0.164	7vggA.pdb.gz
18	PDB:7mqaLO	0.173	0.181	9.188E-10	819	0.090	0.096	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7mq8LO	0.164	0.167	1.208E-9	848	0.084	0.087	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:3jcmB	0.265	0.503	1.518E-9	429	0.059	0.121	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PGF3	0.0	1510	828	0.864	0.915	MED16_MOUSE Mediator of RNA polymerase II transcription subunit 16 OS=Mus musculus OX=10090 GN=Med16 PE=1 SV=2
2	Q9Y2X0	0.0	1789	877	1.000	1.000	MED16_HUMAN Mediator of RNA polymerase II transcription subunit 16 OS=Homo sapiens OX=9606 GN=MED16 PE=1 SV=2
3	Q9W278	1.10e-74	263	818	0.286	0.307	MED16_DROME Mediator of RNA polymerase II transcription subunit 16 OS=Drosophila melanogaster OX=7227 GN=MED16 PE=1 SV=2
4	A0A509AF89	0.18	37.7	354	0.024	0.059	ARGI_PLABA Arginase OS=Plasmodium berghei (strain Anka) OX=5823 GN=ARG PE=3 SV=1
5	O94365	0.18	37.7	494	0.016	0.028	UTP15_SCHPO U3 small nucleolar RNA-associated protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=utp15 PE=3 SV=1
6	Q54QH0	0.23	37.4	342	0.014	0.035	Q54QH0_DICDI WD40 repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=rae1 PE=4 SV=1
7	A4D1P6	0.34	37.0	747	0.024	0.028	WDR91_HUMAN WD repeat-containing protein 91 OS=Homo sapiens OX=9606 GN=WDR91 PE=1 SV=2
8	Q9V9V0	0.50	36.2	424	0.023	0.047	Q9V9V0_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=CstF50 PE=1 SV=1
9	Q11176	0.52	36.6	611	0.017	0.025	WDR1_CAEEL Actin-interacting protein 1 OS=Caenorhabditis elegans OX=6239 GN=unc-78 PE=1 SV=1
10	Q9W097	0.52	36.6	1205	0.022	0.016	Q9W097_DROME LD29485p OS=Drosophila melanogaster OX=7227 GN=Oseg4 PE=2 SV=1
11	P38262	0.74	35.8	535	0.032	0.052	SIF2_YEAST SIR4-interacting protein SIF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIF2 PE=1 SV=2
12	Q5PRA9	1.5	35.0	777	0.018	0.021	Q5PRA9_DANRE Intraflagellar transport 80 homolog (Chlamydomonas) OS=Danio rerio OX=7955 GN=wu:fj11a06 PE=2 SV=1
13	Q9C1X1	1.5	35.0	854	0.013	0.013	PWP2_SCHPO Periodic tryptophan protein 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC713.04c PE=1 SV=1
14	Q551N8	1.8	34.7	513	0.016	0.027	Q551N8_DICDI WD40 repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=ercc8 PE=4 SV=1
15	Q8TED0	1.9	34.7	518	0.016	0.027	UTP15_HUMAN U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens OX=9606 GN=UTP15 PE=1 SV=3
16	O02482	2.2	34.3	612	0.016	0.023	UNC37_CAEEL Transcription factor unc-37 OS=Caenorhabditis elegans OX=6239 GN=unc-37 PE=1 SV=1
17	O60907	2.3	34.3	577	0.023	0.035	TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens OX=9606 GN=TBL1X PE=1 SV=3
18	Q8TBZ3	2.3	34.3	569	0.043	0.067	WDR20_HUMAN WD repeat-containing protein 20 OS=Homo sapiens OX=9606 GN=WDR20 PE=1 SV=2
19	H0Y8P4	2.4	34.3	545	0.016	0.026	H0Y8P4_HUMAN U3 small nucleolar RNA-associated protein 15 homolog (Fragment) OS=Homo sapiens OX=9606 GN=UTP15 PE=1 SV=1
20	Q9QXE7	3.0	33.9	527	0.023	0.038	TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus OX=10090 GN=Tbl1x PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	2.4	19.8	Anaphase-promoting complex subunit 4 WD40 domain
2	PF11635 Med16	4.6e-117	403.6	Mediator complex subunit 16
3	PF00400 WD40	2.6	20.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325612

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258648	0.997	Mediator of RNA polymerase II transcription subunit 4
2	9606.ENSP00000263205	0.997	Mediator of RNA polymerase II transcription subunit 15
3	9606.ENSP00000314343	0.997	Mediator of RNA polymerase II transcription subunit 29
4	9606.ENSP00000323720	0.997	Mediator of RNA polymerase II transcription subunit 14
5	9606.ENSP00000290663	0.996	Mediator of RNA polymerase II transcription subunit 8
6	9606.ENSP00000362948	0.996	Mediator of RNA polymerase II transcription subunit 18
7	9606.ENSP00000363193	0.996	Mediator of RNA polymerase II transcription subunit 12
8	9606.ENSP00000377686	0.996	Mediator of RNA polymerase II transcription subunit 24
9	9606.ENSP00000251871	0.995	Mediator of RNA polymerase II transcription subunit 17
10	9606.ENSP00000255764	0.995	Mediator of RNA polymerase II transcription subunit 10
11	9606.ENSP00000293777	0.995	Mediator of RNA polymerase II transcription subunit 11
12	9606.ENSP00000380888	0.995	Mediator of RNA polymerase II transcription subunit 13
13	9606.ENSP00000337340	0.994	Mediator of RNA polymerase II transcription subunit 19
14	9606.ENSP00000370938	0.994	Cyclin-dependent kinase 8
15	9606.ENSP00000282892	0.993	Mediator of RNA polymerase II transcription subunit 21
16	9606.ENSP00000300651	0.993	Mediator of RNA polymerase II transcription subunit 1
17	9606.ENSP00000357047	0.993	Mediator of RNA polymerase II transcription subunit 23
18	9606.ENSP00000481920	0.993	Mediator of RNA polymerase II transcription subunit 6
19	9606.ENSP00000292035	0.991	Mediator of RNA polymerase II transcription subunit 27
20	9606.ENSP00000286317	0.990	Mediator of RNA polymerase II transcription subunit 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0046966	1.000	nuclear thyroid hormone receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.997	organic substance metabolic process
GO:0006351	0.988	DNA-templated transcription
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0006366	0.982	transcription by RNA polymerase II
GO:0010604	0.977	positive regulation of macromolecule metabolic process
GO:0031325	0.977	positive regulation of cellular metabolic process
GO:0006357	0.977	regulation of transcription by RNA polymerase II
GO:0051173	0.960	positive regulation of nitrogen compound metabolic process
GO:0045893	0.951	positive regulation of DNA-templated transcription
GO:0045944	0.941	positive regulation of transcription by RNA polymerase II
GO:2000142	0.702	regulation of DNA-templated transcription initiation
GO:2000144	0.685	positive regulation of DNA-templated transcription initiation
GO:0060260	0.595	regulation of transcription initiation by RNA polymerase II
GO:0060261	0.555	positive regulation of transcription initiation by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016592	1.000	mediator complex
GO:0005654	1.000	nucleoplasm
GO:0016020	0.981	membrane
GO:0090575	0.937	RNA polymerase II transcription regulator complex
GO:0070847	0.916	core mediator complex
GO:0005737	0.338	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]