StarFunc result for job id Q9Y2X7

User Input

>input (761 residues)
MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTL
LQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKL
PCRDDDGVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQT
LQAELLVVYGADPGSPDVNGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPD
HKNGHYIIPQMADSLDLSELAKAAKKKLQALSNRLFEELAMDVYDEVDRRENDAVWLATQ
NHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSEAKRRQQGKSL
SSPTDNLELSLRSQSDLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGA
VTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAENLQLRQPPGPVPT
PPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELE
DDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYEN
TQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLPSTEDVILKTEQVTKNIQELL
RAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTV
PPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68FF6	0.676	0.668	4.468E-90	770	0.978	0.966	Q68FF6.pdb.gz	GIT1_MOUSE ARF GTPase-activating protein GIT1 OS=Mus musculus OX=10090 GN=Git1 PE=1 SV=1
2	AFDB:A0A0C4DGN6	0.483	0.492	7.261E-89	747	0.970	0.988	A0A0C4DGN6.pdb.gz	A0A0C4DGN6_HUMAN GIT ArfGAP 1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=1
3	AFDB:Q9DG15	0.488	0.502	3.248E-81	740	0.854	0.878	Q9DG15.pdb.gz	Q9DG15_CHICK p95-APP1 OS=Gallus gallus OX=9031 PE=2 SV=1
4	AFDB:A0A0R4IPR8	0.532	0.532	1.151E-70	761	0.761	0.761	A0A0R4IPR8.pdb.gz	A0A0R4IPR8_DANRE ARF GTPase-activating protein GIT1 isoform X1 OS=Danio rerio OX=7955 GN=git1 PE=1 SV=1
5	AFDB:Q9DE64	0.652	0.655	1.151E-68	757	0.673	0.676	Q9DE64.pdb.gz	Q9DE64_CHICK p95-APP2 OS=Gallus gallus OX=9031 GN=p95-APP2 PE=2 SV=1
6	AFDB:Q14161	0.643	0.644	1.579E-65	759	0.664	0.665	Q14161.pdb.gz	GIT2_HUMAN ARF GTPase-activating protein GIT2 OS=Homo sapiens OX=9606 GN=GIT2 PE=1 SV=2
7	AFDB:A2BG45	0.672	0.682	3.449E-64	750	0.619	0.628	A2BG45.pdb.gz	A2BG45_DANRE ARF GTPase-activating protein GIT2 OS=Danio rerio OX=7955 GN=git2 PE=4 SV=1
8	AFDB:Q9JLQ2	0.489	0.525	1.224E-61	708	0.614	0.660	Q9JLQ2.pdb.gz	GIT2_MOUSE ARF GTPase-activating protein GIT2 OS=Mus musculus OX=10090 GN=Git2 PE=1 SV=2
9	PDB:3lvqE	0.220	0.370	1.131E-8	420	0.084	0.152	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
10	PDB:3ljuX	0.133	0.263	9.544E-5	373	0.047	0.097	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
11	AFDB:Q8WZ64	0.206	0.094	1.592E-4	1704	0.075	0.033	Q8WZ64.pdb.gz	ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3
12	PDB:6jd6B	0.119	0.416	8.405E-3	192	0.055	0.219	6jd6B.pdb.gz
13	PDB:3o47A	0.095	0.221	1.083E-2	289	0.039	0.104	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
14	PDB:2dvwA	0.117	0.372	1.395E-2	229	0.045	0.148	2dvwA.pdb.gz
15	PDB:1bd8A	0.119	0.525	1.518E-2	156	0.041	0.199	1bd8A.pdb.gz
16	PDB:1a5eA	0.120	0.494	2.861E-2	156	0.042	0.205	1a5eA.pdb.gz
17	PDB:1bu9A	0.110	0.474	3.846E-2	168	0.038	0.173	1bu9A.pdb.gz
18	PDB:1d9sA	0.109	0.533	3.846E-2	136	0.043	0.243	1d9sA.pdb.gz
19	AFDB:Q9M354	0.099	0.157	4.031E-2	459	0.104	0.172	Q9M354.pdb.gz	AGD6_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD6 OS=Arabidopsis thaliana OX=3702 GN=AGD6 PE=1 SV=1
20	PDB:8cs9A	0.115	0.110	4.956E-2	796	0.059	0.057	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGN6	0.0	1502	747	0.970	0.988	A0A0C4DGN6_HUMAN GIT ArfGAP 1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=1
2	A0A0R4IPR8	0.0	1077	761	0.762	0.762	A0A0R4IPR8_DANRE ARF GTPase-activating protein GIT1 isoform X1 OS=Danio rerio OX=7955 GN=git1 PE=1 SV=1
3	A2BG45	0.0	894	750	0.623	0.632	A2BG45_DANRE ARF GTPase-activating protein GIT2 OS=Danio rerio OX=7955 GN=git2 PE=4 SV=1
4	E7FAZ2	0.0	1085	752	0.762	0.771	E7FAZ2_DANRE ARF GTPase-activating protein GIT1 isoform X2 OS=Danio rerio OX=7955 GN=git1 PE=1 SV=1
5	J3QRU8	0.0	1425	694	0.908	0.996	J3QRU8_HUMAN GIT ArfGAP 1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=1
6	Q14161	0.0	978	759	0.670	0.672	GIT2_HUMAN ARF GTPase-activating protein GIT2 OS=Homo sapiens OX=9606 GN=GIT2 PE=1 SV=2
7	Q68FF6	0.0	1522	770	0.978	0.966	GIT1_MOUSE ARF GTPase-activating protein GIT1 OS=Mus musculus OX=10090 GN=Git1 PE=1 SV=1
8	Q9DE64	0.0	979	757	0.679	0.683	Q9DE64_CHICK p95-APP2 OS=Gallus gallus OX=9031 GN=p95-APP2 PE=2 SV=1
9	Q9DG15	0.0	1258	740	0.857	0.881	Q9DG15_CHICK p95-APP1 OS=Gallus gallus OX=9031 PE=2 SV=1
10	Q9JLQ2	0.0	885	708	0.624	0.671	GIT2_MOUSE ARF GTPase-activating protein GIT2 OS=Mus musculus OX=10090 GN=Git2 PE=1 SV=2
11	Q9Y2X7	0.0	1567	761	1.000	1.000	GIT1_HUMAN ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2
12	Q9Z272	0.0	1465	770	0.968	0.957	GIT1_RAT ARF GTPase-activating protein GIT1 OS=Rattus norvegicus OX=10116 GN=Git1 PE=1 SV=1
13	Q95RG8	5.27e-129	402	731	0.310	0.323	GIT_DROME ARF GTPase-activating protein Git OS=Drosophila melanogaster OX=7227 GN=Git PE=1 SV=1
14	J3QL89	8.60e-103	315	177	0.202	0.870	J3QL89_HUMAN GIT ArfGAP 1 (Fragment) OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=1
15	Q19467	4.84e-76	261	670	0.218	0.248	Q19467_CAEEL Arf-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=git-1 PE=1 SV=2
16	U6A022	3.21e-30	130	808	0.100	0.094	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
17	Q8VHH5	9.63e-30	129	910	0.100	0.084	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
18	Q9UPQ3	5.46e-29	126	857	0.099	0.088	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
19	J3KNM6	2.48e-28	124	1036	0.096	0.070	J3KNM6_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
20	A0JMI1	2.73e-28	124	827	0.105	0.097	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.9	20.3	Ankyrin repeat
2	PF12796 Ank_2	1.2e-06	40.3	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	16	17.3	Ankyrin repeat
4	PF13637 Ank_4	0.00056	31.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.0013	30.3	Ankyrin repeats (many copies)
6	PF01412 ArfGap	7.8e-23	92.2	Putative GTPase activating protein for Arf
7	PF08702 Fib_alpha	4.1e+02	12.5	Fibrinogen alpha/beta chain family
8	PF12205 GIT1_C	3.1e-28	109.6	G protein-coupled receptor kinase-interacting protein 1 C term
9	PF16559 GIT_CC	8.5e-28	107.2	GIT coiled-coil Rho guanine nucleotide exchange factor
10	PF08518 GIT_SHD	2.8e-22	89.3	Spa2 homology domain (SHD) of GIT
11	PF13543 SAM_KSR1	6.3e+02	11.9	SAM like domain present in kinase suppressor RAS 1
12	PF07558 Shugoshin_N	1.6	19.9	Shugoshin N-terminal coiled-coil region
13	PF06156 YabA	3.8e+02	13.1	Initiation control protein YabA
14	PF06005 ZapB	64	15.4	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000019925

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000004158	0.998	Cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion).
2	9555.ENSPANP00000009962	0.998	Rho guanine nucleotide exchange factor (GEF) 7
3	9555.ENSPANP00000008426	0.994	Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
4	9555.ENSPANP00000008134	0.903	ADP-ribosylation factor 6
5	9555.ENSPANP00000002703	0.897	Belongs to the protein kinase superfamily. Tyr protein kinase family
6	9555.ENSPANP00000006618	0.895	P21 protein (Cdc42/Rac)-activated kinase 1
7	9555.ENSPANP00000007898	0.881	Adrenergic, beta, receptor kinase 1
8	9555.ENSPANP00000001304	0.868	P21 protein (Cdc42/Rac)-activated kinase 3
9	9555.ENSPANP00000012046	0.860	NCK adaptor protein 2
10	9555.ENSPANP00000002361	0.858	Cell division cycle 42
11	9555.ENSPANP00000001877	0.853	P21 protein (Cdc42/Rac)-activated kinase 2
12	9555.ENSPANP00000003576	0.850	NCK adaptor protein 1
13	9555.ENSPANP00000012594	0.849	Transforming growth factor beta 1 induced transcript 1
14	9555.ENSPANP00000007563	0.829	PTPRF interacting protein alpha 1
15	9555.ENSPANP00000017765	0.791	Tyrosine-protein kinase
16	9555.ENSPANP00000007679	0.782	Adrenergic, beta, receptor kinase 2
17	9555.ENSPANP00000010036	0.772	G protein-coupled receptor kinase 6
18	9555.ENSPANP00000011115	0.758	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.
19	9555.ENSPANP00000008352	0.744	PTPRF interacting protein alpha 3
20	9555.ENSPANP00000016594	0.744	G protein-coupled receptor kinase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.910	enzyme binding
GO:0051020	0.483	GTPase binding
GO:0098772	0.457	molecular function regulator activity
GO:0031267	0.443	small GTPase binding
GO:0030234	0.393	enzyme regulator activity
GO:0044877	0.351	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.980	cellular process
GO:0023051	0.932	regulation of signaling
GO:0048583	0.923	regulation of response to stimulus
GO:0010646	0.915	regulation of cell communication
GO:0008277	0.872	regulation of G protein-coupled receptor signaling pathway
GO:0050896	0.846	response to stimulus
GO:0048518	0.723	positive regulation of biological process
GO:0048522	0.694	positive regulation of cellular process
GO:0032501	0.686	multicellular organismal process
GO:0051716	0.598	cellular response to stimulus
GO:0032502	0.578	developmental process
GO:0048856	0.553	anatomical structure development
GO:0051179	0.498	localization
GO:0071840	0.478	cellular component organization or biogenesis
GO:0016043	0.448	cellular component organization
GO:0048519	0.437	negative regulation of biological process
GO:0051128	0.428	regulation of cellular component organization
GO:0019222	0.421	regulation of metabolic process
GO:0007154	0.410	cell communication
GO:0048523	0.409	negative regulation of cellular process
GO:0023052	0.406	signaling
GO:0007165	0.383	signal transduction
GO:0007275	0.361	multicellular organism development
GO:0031323	0.347	regulation of cellular metabolic process
GO:0060255	0.309	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0030055	0.995	cell-substrate junction
GO:0005925	0.994	focal adhesion
GO:0016020	0.989	membrane
GO:0071944	0.948	cell periphery
GO:0005886	0.900	plasma membrane
GO:0005739	0.812	mitochondrion
GO:0005634	0.735	nucleus
GO:0120025	0.708	plasma membrane bounded cell projection
GO:0043232	0.615	intracellular non-membrane-bounded organelle
GO:0070013	0.495	intracellular organelle lumen
GO:0032991	0.480	protein-containing complex
GO:0005654	0.458	nucleoplasm
GO:0005856	0.308	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]