StarFunc result for job id Q9Y2X8

User Input

>input (147 residues)
MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV
PEIAHTYKADREKYNRLAREWTQKYAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5PKP9	1.000	1.000	2.709E-32	147	0.980	0.980	A5PKP9.pdb.gz	UB2D4_XENLA Ubiquitin-conjugating enzyme E2 D4 OS=Xenopus laevis OX=8355 GN=ube2d4 PE=1 SV=1
2	AFDB:P70711	0.999	0.999	4.559E-30	147	0.871	0.871	P70711.pdb.gz	U2D2B_RAT Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norvegicus OX=10116 GN=Ube2d2b PE=1 SV=1
3	PDB:3ptfA	0.986	0.948	1.353E-28	153	0.918	0.882	3ptfA.pdb.gz
4	AFDB:Q8I607	0.998	0.998	2.164E-28	147	0.762	0.762	Q8I607.pdb.gz	Q8I607_PLAF7 Ubiquitin-conjugating enzyme E2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1203900 PE=3 SV=1
5	AFDB:P46595	0.996	0.996	2.969E-28	147	0.837	0.837	P46595.pdb.gz	UBC4_SCHPO Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc4 PE=1 SV=1
6	AFDB:Q9SLE4	0.997	0.991	5.248E-28	148	0.769	0.764	Q9SLE4.pdb.gz	UBC29_ARATH Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana OX=3702 GN=UBC29 PE=2 SV=1
7	AFDB:Q9FKT3	0.998	0.991	5.956E-28	148	0.816	0.811	Q9FKT3.pdb.gz	UBC30_ARATH Ubiquitin-conjugating enzyme E2 30 OS=Arabidopsis thaliana OX=3702 GN=UBC30 PE=1 SV=1
8	AFDB:P15731	0.989	0.983	1.273E-27	148	0.796	0.791	P15731.pdb.gz	UBC4_YEAST Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC4 PE=1 SV=1
9	AFDB:F4JKF3	0.997	0.824	2.897E-27	178	0.803	0.663	F4JKF3.pdb.gz	F4JKF3_ARATH Ubiquitin conjugating enzyme 9 OS=Arabidopsis thaliana OX=3702 GN=UBC9 PE=3 SV=1
10	PDB:4ddgA	0.976	0.364	1.557E-26	399	0.925	0.341	4ddgA.pdb.gz
11	PDB:4ii2C	0.975	0.962	1.257E-25	149	0.823	0.812	4ii2C.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
12	AFDB:Q96LR5	0.996	0.729	1.771E-25	201	0.626	0.458	Q96LR5.pdb.gz	UB2E2_HUMAN Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens OX=9606 GN=UBE2E2 PE=1 SV=1
13	PDB:5aieB	0.972	0.953	1.957E-25	150	0.796	0.780	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.
14	AFDB:P52485	0.990	0.628	2.589E-25	232	0.639	0.405	P52485.pdb.gz	UBCD2_DROME Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc2 PE=2 SV=1
15	PDB:4x57C	0.983	0.970	3.926E-25	149	0.803	0.792	4x57C.pdb.gz
16	PDB:4r8pL	0.970	0.567	5.387E-25	254	0.912	0.528	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
17	PDB:3bzhA	0.984	0.899	6.513E-25	161	0.626	0.571	3bzhA.pdb.gz
18	PDB:7jzvA	0.876	0.531	2.034E-24	253	0.905	0.526	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
19	PDB:2aakA	0.948	0.929	2.986E-19	150	0.456	0.447	2aakA.pdb.gz
20	PDB:7bbdC	0.930	0.895	8.218E-19	153	0.449	0.431	7bbdC.pdb.gz	RING domains act as both substrate and enzyme in a catalytic arrangement to drive self-anchored ubiquitination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2X8	1.71e-109	309	147	1.000	1.000	UB2D4_HUMAN Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens OX=9606 GN=UBE2D4 PE=1 SV=1
2	A5PKP9	8.88e-108	305	147	0.980	0.980	UB2D4_XENLA Ubiquitin-conjugating enzyme E2 D4 OS=Xenopus laevis OX=8355 GN=ube2d4 PE=1 SV=1
3	P62837	2.09e-103	293	147	0.932	0.932	UB2D2_HUMAN Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens OX=9606 GN=UBE2D2 PE=1 SV=1
4	P62838	2.09e-103	293	147	0.932	0.932	UB2D2_MOUSE Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus OX=10090 GN=Ube2d2 PE=1 SV=1
5	P62839	2.09e-103	293	147	0.932	0.932	UB2D2_RAT Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norvegicus OX=10116 GN=Ube2d2 PE=1 SV=1
6	Q7ZUK1	7.22e-103	292	147	0.932	0.932	Q7ZUK1_DANRE Ubiquitin-conjugating enzyme E2 D2 OS=Danio rerio OX=7955 GN=zgc:55886 PE=2 SV=1
7	P61077	1.21e-102	291	147	0.918	0.918	UB2D3_HUMAN Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens OX=9606 GN=UBE2D3 PE=1 SV=1
8	P61078	1.21e-102	291	147	0.918	0.918	UB2D3_RAT Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norvegicus OX=10116 GN=Ube2d3 PE=2 SV=1
9	P61079	1.21e-102	291	147	0.918	0.918	UB2D3_MOUSE Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus OX=10090 GN=Ube2d3 PE=1 SV=1
10	P35129	1.34e-101	289	147	0.925	0.925	UBC2_CAEEL Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditis elegans OX=6239 GN=let-70 PE=1 SV=1
11	D3ZDK2	6.01e-101	287	147	0.918	0.918	UB2D1_RAT Ubiquitin-conjugating enzyme E2 D1 OS=Rattus norvegicus OX=10116 GN=Ube2d1 PE=1 SV=1
12	P51668	6.01e-101	287	147	0.918	0.918	UB2D1_HUMAN Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens OX=9606 GN=UBE2D1 PE=1 SV=1
13	P61080	6.01e-101	287	147	0.918	0.918	UB2D1_MOUSE Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus OX=10090 GN=Ube2d1 PE=1 SV=1
14	P25867	8.45e-101	287	147	0.925	0.925	UBCD1_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster OX=7227 GN=eff PE=1 SV=1
15	P70711	1.00e-96	276	147	0.871	0.871	U2D2B_RAT Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norvegicus OX=10116 GN=Ube2d2b PE=1 SV=1
16	P46595	1.87e-92	266	147	0.837	0.837	UBC4_SCHPO Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc4 PE=1 SV=1
17	Q8S920	7.21e-91	262	147	0.816	0.816	UBC5A_ORYSJ Ubiquitin-conjugating enzyme E2 5A OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5A PE=2 SV=1
18	P15731	4.52e-89	257	148	0.796	0.791	UBC4_YEAST Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC4 PE=1 SV=1
19	Q6FV50	5.09e-89	257	147	0.803	0.803	Q6FV50_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0E04752g PE=3 SV=1
20	Q9FKT3	6.56e-89	257	148	0.816	0.811	UBC30_ARATH Ubiquitin-conjugating enzyme E2 30 OS=Arabidopsis thaliana OX=3702 GN=UBC30 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05773 RWD	17	17.1	RWD domain
2	PF05743 UEV	1.8e+02	13.4	UEV domain
3	PF00179 UQ_con	6.8e-51	183.0	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004110

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016601	0.905	Thyroid hormone receptor interactor 12
2	61853.ENSNLEP00000009975	0.873	STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
3	61853.ENSNLEP00000018730	0.853	Ring-box 1, E3 ubiquitin protein ligase
4	61853.ENSNLEP00000012568	0.852	Anaphase promoting complex subunit 11
5	61853.ENSNLEP00000003842	0.827	Ubiquitin-like modifier activating enzyme 1
6	61853.ENSNLEP00000014631	0.824	Breast cancer type 1 susceptibility protein homolog
7	61853.ENSNLEP00000004551	0.814	MDM2 proto-oncogene, E3 ubiquitin protein ligase
8	61853.ENSNLEP00000016216	0.794	Ubiquitin-conjugating enzyme E2 variant 2
9	61853.ENSNLEP00000011143	0.791	Ubiquitin-like modifier activating enzyme 6
10	61853.ENSNLEP00000012166	0.785	Baculoviral IAP repeat containing 7
11	61853.ENSNLEP00000005780	0.781	OTU deubiquitinase, ubiquitin aldehyde binding 1
12	61853.ENSNLEP00000020782	0.777	Ubiquitin-conjugating enzyme E2K
13	61853.ENSNLEP00000023253	0.764	Cullin 1
14	61853.ENSNLEP00000008789	0.757	BRCA1 associated RING domain 1
15	61853.ENSNLEP00000010055	0.755	Neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
16	61853.ENSNLEP00000008520	0.751	Ubiquitin-conjugating enzyme E2 variant 1
17	61853.ENSNLEP00000016234	0.747	CCR4-NOT transcription complex, subunit 4
18	61853.ENSNLEP00000021902	0.737	Ring finger protein 2
19	61853.ENSNLEP00000011094	0.714	Anaphase promoting complex subunit 2
20	61853.ENSNLEP00000008247	0.710	Ubiquitin-conjugating enzyme E2C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061631	0.972	ubiquitin conjugating enzyme activity
GO:0019899	0.690	enzyme binding
GO:0044389	0.509	ubiquitin-like protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0019538	0.990	protein metabolic process
GO:0009987	0.982	cellular process
GO:0036211	0.930	protein modification process
GO:0016567	0.906	protein ubiquitination
GO:0044237	0.898	cellular metabolic process
GO:0044260	0.827	cellular macromolecule metabolic process
GO:0043632	0.777	modification-dependent macromolecule catabolic process
GO:0019941	0.756	modification-dependent protein catabolic process
GO:0006511	0.750	ubiquitin-dependent protein catabolic process
GO:0065007	0.749	biological regulation
GO:0050789	0.733	regulation of biological process
GO:0000209	0.570	protein polyubiquitination
GO:0050794	0.455	regulation of cellular process
GO:0019222	0.348	regulation of metabolic process
GO:0048518	0.335	positive regulation of biological process
GO:0060255	0.329	regulation of macromolecule metabolic process
GO:0050896	0.313	response to stimulus
GO:0070936	0.312	protein K48-linked ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.997	nucleoplasm
GO:0032991	0.977	protein-containing complex
GO:0140535	0.820	intracellular protein-containing complex
GO:1990234	0.809	transferase complex
GO:0000151	0.758	ubiquitin ligase complex
GO:0005576	0.593	extracellular region
GO:0031982	0.545	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.
EC:2.3.2.23	0.972	E2 ubiquitin-conjugating enzyme.

[back to server]