StarFunc result for job id Q9Y2X9

User Input

>input (895 residues)
MKIGSGFLSGGGGTGSSGGSGSGGGGSGGGGGGGSSGRRAEMEPTFPQGMVMFNHRLPPV
TSFTRPAGSAAPPPQCVLSSSTSAAPAAEPPPPPAPDMTFKKEPAASAAAFPSQRTSWGF
LQSLVSIKQEKPADPEEQQSHHHHHHHHYGGLFAGAEERSPGLGGGEGGSHGVIQDLSIL
HQHVQQQPAQHHRDVLLSSSSRTDDHHGTEEPKQDTNVKKAKRPKPESQGIKAKRKPSAS
SKPSLVGDGEGAILSPSQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFIQ
KYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSRTDRL
LKHRRTCGEVIVKGATSAEPGSSNHTNMGNLAVLSQGNTSSSRRKTKSKSIAIENKEQKT
GKTNESQISNNINMQSYSVEMPTVSSSGGIIGTGIDELQKRVPKLIFKKGSRKNTDKNYL
NFVSPLPDIVGQKSLSGKPSGSLGIVSNNSVETIGLLQSTSGKQGQISSNYDDAMQFSKK
RRYLPTASSNSAFSINVGHMVSQQSVIQSAGVSVLDNEAPLSLIDSSALNAEIKSCHDKS
GIPDEVLQSILDQYSNKSESQKEDPFNIAEPRVDLHTSGEHSELVQEENLSPGTQTPSND
KASMLQEYSKYLQQAFEKSTNASFTLGHGFQFVSLSSPLHNHTLFPEKQIYTTSPLECGF
GQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLIDSQKNLETSSA
FQSSSQKLTSQKEQKNLESSTGFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFK
SGSRVPMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2X9	1.000	1.000	0.000	895	1.000	1.000	Q9Y2X9.pdb.gz	ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 PE=1 SV=1
2	AFDB:A0A2R8QDL5	0.078	0.063	2.374E-13	1191	0.163	0.123	A0A2R8QDL5.pdb.gz
3	AFDB:B0LVF0	0.080	0.061	1.923E-12	1219	0.162	0.119	B0LVF0.pdb.gz	B0LVF0_DANRE SIP1b OS=Danio rerio OX=7955 GN=zfhx1b PE=2 SV=1
4	AFDB:P47806	0.112	0.092	1.281E-11	1111	0.191	0.154	P47806.pdb.gz	GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus OX=10090 GN=Gli1 PE=1 SV=4
5	AFDB:P08151	0.109	0.090	3.415E-11	1106	0.181	0.146	P08151.pdb.gz	GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens OX=9606 GN=GLI1 PE=1 SV=1
6	AFDB:Q9IA31	0.123	0.079	2.592E-10	1544	0.208	0.120	Q9IA31.pdb.gz	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
7	AFDB:Q13127	0.101	0.083	1.940E-8	1097	0.184	0.150	Q13127.pdb.gz	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
8	AFDB:F1QH64	0.118	0.088	6.292E-8	1225	0.180	0.131	F1QH64.pdb.gz
9	AFDB:Q9P1Z0	0.102	0.091	3.022E-7	1013	0.154	0.136	Q9P1Z0.pdb.gz	ZBTB4_HUMAN Zinc finger and BTB domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBTB4 PE=1 SV=3
10	AFDB:Q61602	0.129	0.080	3.444E-7	1583	0.183	0.104	Q61602.pdb.gz	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
11	PDB:3w5kB	0.060	0.278	3.124E-5	110	0.041	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5a31B	0.030	0.169	6.903E-1	84	0.021	0.226	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
13	PDB:8a3tU	0.031	0.138	3.315	114	0.020	0.158	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
14	PDB:7qo48	0.043	0.083	3.539	372	0.017	0.040	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
15	PDB:7c4jB	0.030	0.056	6.374	395	0.025	0.056	7c4jB.pdb.gz
16	PDB:5xbtA	0.031	0.077	7.265	271	0.016	0.052	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
17	PDB:3blvC	0.023	0.046	7.755	344	0.007	0.017	3blvC.pdb.gz	Allosteric Motions in Structures of Yeast NAD+-specific Isocitrate Dehydrogenase.
18	PDB:6qx91C	0.027	0.296	7.755	50	0.007	0.120	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	PDB:7uhyD	0.024	0.066	8.839	288	0.023	0.073	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99LI5	0.0	1533	893	0.917	0.919	ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus OX=10090 GN=Znf281 PE=1 SV=1
2	Q9Y2X9	0.0	1837	895	1.000	1.000	ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 PE=1 SV=1
3	Q9UQR1	2.15e-117	378	794	0.267	0.301	ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens OX=9606 GN=ZNF148 PE=1 SV=2
4	Q62806	3.84e-115	372	794	0.264	0.297	ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus OX=10116 GN=Znf148 PE=1 SV=1
5	Q61624	1.68e-114	370	794	0.265	0.298	ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus OX=10090 GN=Znf148 PE=1 SV=2
6	A0MS83	2.77e-109	357	808	0.287	0.318	ZN148_DANRE Zinc finger protein 148 OS=Danio rerio OX=7955 GN=znf148 PE=2 SV=2
7	Q15552	1.83e-57	206	454	0.128	0.253	Q15552_HUMAN CACCC box-binding protein OS=Homo sapiens OX=9606 GN=tb protein PE=2 SV=1
8	Q8NDX6	8.91e-30	119	193	0.063	0.290	ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens OX=9606 GN=ZNF740 PE=1 SV=1
9	Q9UJW8	1.40e-26	118	692	0.057	0.074	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
10	P10073	2.01e-25	113	491	0.064	0.116	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
11	Q3UT31	2.21e-25	110	312	0.072	0.205	Q3UT31_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Platr25 PE=2 SV=1
12	P17097	2.75e-25	114	686	0.061	0.080	ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens OX=9606 GN=ZNF7 PE=1 SV=1
13	A0A1Y7VLS7	3.07e-25	109	312	0.072	0.205	A0A1Y7VLS7_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1
14	A8DYD2	4.58e-25	114	825	0.049	0.053	A8DYD2_DROME Combgap, isoform J OS=Drosophila melanogaster OX=7227 GN=cg PE=1 SV=2
15	A8DYD1	4.67e-25	114	837	0.049	0.053	A8DYD1_DROME Combgap, isoform L OS=Drosophila melanogaster OX=7227 GN=cg PE=1 SV=2
16	A0A0B4LFC7	4.79e-25	114	780	0.049	0.056	A0A0B4LFC7_DROME Combgap, isoform M OS=Drosophila melanogaster OX=7227 GN=cg PE=1 SV=1
17	A8DYD3	5.02e-25	114	770	0.049	0.057	A8DYD3_DROME Combgap, isoform F OS=Drosophila melanogaster OX=7227 GN=cg PE=1 SV=1
18	A1Z9M3	5.36e-25	114	772	0.049	0.057	A1Z9M3_DROME Combgap, isoform B OS=Drosophila melanogaster OX=7227 GN=cg PE=1 SV=1
19	B7YZE6	5.56e-25	114	773	0.049	0.057	B7YZE6_DROME Combgap, isoform I OS=Drosophila melanogaster OX=7227 GN=cg PE=1 SV=1
20	A0A126GUP1	5.82e-25	113	686	0.049	0.064	A0A126GUP1_DROME Combgap, isoform N OS=Drosophila melanogaster OX=7227 GN=cg PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01363 FYVE	3.6e+02	12.7	FYVE zinc finger
2	PF11104 PilM_2	5.1e+02	11.0	Type IV pilus assembly protein PilM;
3	PF00096 zf-C2H2	8.5e-08	43.4	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	10	18.3	C2H2-type zinc finger
5	PF13465 zf-H2C2_2	5e-15	66.4	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294740

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229307	0.941	Homeobox protein NANOG
2	9606.ENSP00000334458	0.854	Transcription factor GATA-4
3	9606.ENSP00000292431	0.668	Nucleus accumbens-associated protein 1
4	9606.ENSP00000368253	0.625	Nuclear receptor subfamily 0 group B member 1
5	9606.ENSP00000262225	0.584	Transmembrane emp24 domain-containing protein 2
6	9606.ENSP00000265627	0.573	Serum paraoxonase/lactonase 3
7	9606.ENSP00000303398	0.552	Mdm2-binding protein
8	9606.ENSP00000259915	0.546	POU domain, class 5, transcription factor 1
9	9606.ENSP00000323588	0.543	Transcription factor SOX-2
10	9606.ENSP00000261593	0.536	E3 ubiquitin-protein ligase RNF138
11	9606.ENSP00000479618	0.514	Myc proto-oncogene protein
12	9606.ENSP00000295488	0.513	Helicase POLQ-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0006355	0.976	regulation of DNA-templated transcription
GO:0048519	0.963	negative regulation of biological process
GO:0048523	0.921	negative regulation of cellular process
GO:0048522	0.914	positive regulation of cellular process
GO:0051172	0.910	negative regulation of nitrogen compound metabolic process
GO:0009987	0.908	cellular process
GO:0010605	0.905	negative regulation of macromolecule metabolic process
GO:0006357	0.882	regulation of transcription by RNA polymerase II
GO:0009890	0.880	negative regulation of biosynthetic process
GO:0045892	0.868	negative regulation of DNA-templated transcription
GO:0009893	0.865	positive regulation of metabolic process
GO:0010604	0.833	positive regulation of macromolecule metabolic process
GO:0051173	0.823	positive regulation of nitrogen compound metabolic process
GO:0031325	0.816	positive regulation of cellular metabolic process
GO:0032502	0.806	developmental process
GO:0051254	0.799	positive regulation of RNA metabolic process
GO:1902680	0.780	positive regulation of RNA biosynthetic process
GO:1903508	0.771	positive regulation of nucleic acid-templated transcription
GO:0045893	0.763	positive regulation of DNA-templated transcription
GO:0045944	0.715	positive regulation of transcription by RNA polymerase II
GO:0048856	0.651	anatomical structure development
GO:0032501	0.563	multicellular organismal process
GO:0000122	0.478	negative regulation of transcription by RNA polymerase II
GO:0007275	0.365	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.711	cytoplasm
GO:0005829	0.374	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]