StarFunc result for job id Q9Y2Y0

User Input

>input (163 residues)
MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKL
IYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLA
FKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R6U9	0.849	0.849	3.156E-23	163	1.000	1.000	A0A024R6U9.pdb.gz
2	PDB:3dofB	0.647	0.859	1.632E-13	120	0.712	0.967	3dofB.pdb.gz	Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
3	AFDB:Q8C6E0	0.595	0.308	5.123E-3	343	0.215	0.102	Q8C6E0.pdb.gz	CFA36_MOUSE Cilia- and flagella-associated protein 36 OS=Mus musculus OX=10090 GN=Cfap36 PE=1 SV=1
4	AFDB:Q9VA16	0.360	0.141	1.731E-1	529	0.098	0.030	Q9VA16.pdb.gz	Q9VA16_DROME Sox100B protein OS=Drosophila melanogaster OX=7227 GN=Sox100B PE=2 SV=3
5	AFDB:B3H5V3	0.201	0.113	4.496E-1	329	0.190	0.094	B3H5V3.pdb.gz	B3H5V3_ARATH ABI-1-like 1 OS=Arabidopsis thaliana OX=3702 GN=ABIL1 PE=1 SV=1
6	PDB:4k1cA	0.178	0.115	1.029	374	0.117	0.051	4k1cA.pdb.gz	Structural basis for alternating access of a eukaryotic calcium/proton exchanger.
7	AFDB:O18896	0.175	0.074	1.037	509	0.074	0.024	O18896.pdb.gz	SOX9_PIG Transcription factor SOX-9 OS=Sus scrofa OX=9823 GN=SOX9 PE=2 SV=1
8	AFDB:Q38B23	0.466	0.199	1.037	433	0.166	0.062	Q38B23.pdb.gz	Q38B23_TRYB2 Cilia- and flagella-associated protein 36 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1130 PE=3 SV=1
9	AFDB:Q54PN9	0.212	0.120	1.240	324	0.153	0.077	Q54PN9.pdb.gz	ING1_DICDI Inhibitor of growth protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=dng1 PE=1 SV=1
10	AFDB:O76861	0.237	0.094	1.316	552	0.086	0.025	O76861.pdb.gz	O76861_DROME EG:100G10.1 protein OS=Drosophila melanogaster OX=7227 GN=EG:100G10.1 PE=2 SV=1
11	AFDB:Q9DFH2	0.284	0.130	1.316	462	0.092	0.032	Q9DFH2.pdb.gz	Q9DFH2_DANRE HMG box transcription factor Sox9a OS=Danio rerio OX=7955 GN=jef PE=2 SV=1
12	AFDB:E7FCE4	0.233	0.066	1.397	939	0.117	0.020	E7FCE4.pdb.gz	E7FCE4_DANRE Receptor tyrosine kinase-like orphan receptor 2 OS=Danio rerio OX=7955 GN=ror2 PE=1 SV=1
13	PDB:5l4kT	0.159	0.113	1.472	272	0.135	0.081	5l4kT.pdb.gz
14	PDB:7qxaA	0.195	0.047	1.472	954	0.110	0.019	7qxaA.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
15	PDB:7obqx	0.159	0.079	3.198	393	0.074	0.031	7obqx.pdb.gz	Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
16	PDB:4h54A	0.198	0.123	3.603	274	0.135	0.080	4h54A.pdb.gz	Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
17	PDB:1kmiZ	0.151	0.140	4.310	177	0.135	0.124	1kmiZ.pdb.gz	Structure and catalytic mechanism of the E. coli chemotaxis phosphatase CheZ.
18	PDB:7qp6y	0.156	0.053	4.310	697	0.147	0.034	7qp6y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
19	PDB:5zonA	0.208	0.146	4.575	256	0.061	0.039	5zonA.pdb.gz	Identification and structural characterization of a histidinol phosphate phosphatase from Mycobacterium tuberculosis
20	PDB:7u05B	0.177	0.052	4.575	815	0.117	0.023	7u05B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2Y0	5.75e-118	332	163	1.000	1.000	AR2BP_HUMAN ADP-ribosylation factor-like protein 2-binding protein OS=Homo sapiens OX=9606 GN=ARL2BP PE=1 SV=1
2	Q32PC9	2.06e-111	315	163	0.957	0.957	AR2BP_BOVIN ADP-ribosylation factor-like protein 2-binding protein OS=Bos taurus OX=9913 GN=ARL2BP PE=1 SV=2
3	Q9D385	1.22e-102	293	163	0.957	0.957	AR2BP_MOUSE ADP-ribosylation factor-like protein 2-binding protein OS=Mus musculus OX=10090 GN=Arl2bp PE=1 SV=1
4	Q4V8C5	7.87e-101	288	163	0.945	0.945	AR2BP_RAT ADP-ribosylation factor-like protein 2-binding protein OS=Rattus norvegicus OX=10116 GN=Arl2bp PE=1 SV=2
5	H3BM52	4.22e-88	256	171	0.779	0.743	H3BM52_HUMAN ADP-ribosylation factor-like protein 2-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=ARL2BP PE=1 SV=1
6	Q96G28	0.023	36.6	342	0.184	0.088	CFA36_HUMAN Cilia- and flagella-associated protein 36 OS=Homo sapiens OX=9606 GN=CFAP36 PE=1 SV=2
7	Q8C6E0	0.047	35.8	343	0.196	0.093	CFA36_MOUSE Cilia- and flagella-associated protein 36 OS=Mus musculus OX=10090 GN=Cfap36 PE=1 SV=1
8	Q8ILU6	0.82	32.0	322	0.215	0.109	Q8ILU6_PLAF7 Uracil-DNA glycosylase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1415000 PE=3 SV=1
9	Q6WDI9	7.3	29.3	1000	0.086	0.014	Q6WDI9_RAT V(D)J recombination-activating protein 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rag1 PE=3 SV=1
10	G3V6K9	7.7	29.3	1040	0.086	0.013	G3V6K9_RAT V(D)J recombination-activating protein 1 OS=Rattus norvegicus OX=10116 GN=Rag1 PE=3 SV=1
11	P15919	8.0	29.3	1040	0.086	0.013	RAG1_MOUSE V(D)J recombination-activating protein 1 OS=Mus musculus OX=10090 GN=Rag1 PE=1 SV=2
12	P15918	8.7	29.3	1043	0.086	0.013	RAG1_HUMAN V(D)J recombination-activating protein 1 OS=Homo sapiens OX=9606 GN=RAG1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11527 ARL2_Bind_BART	2.1e-31	119.8	The ARF-like 2 binding protein BART

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219204

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246747	0.998	ADP-ribosylation factor-like protein 2
2	9606.ENSP00000260746	0.827	ADP-ribosylation factor-like protein 3
3	9606.ENSP00000335808	0.756	Protein FAM192A
4	9606.ENSP00000443176	0.737	Ring finger and SPRY domain containing 1
5	9606.ENSP00000262103	0.728	EF-hand calcium-binding domain-containing protein 1
6	9606.ENSP00000380054	0.725	ELL-associated factor 1
7	9606.ENSP00000407613	0.705	S-adenosyl-L-methionine-dependent methyltransferase that mediates N(3)-methylcytidine modification of residue 32 of the tRNA anticodon loop of tRNA(Ser)
8	9606.ENSP00000332062	0.699	Sorting nexin-20
9	9606.ENSP00000281456	0.697	ADP/ATP translocase 1
10	9606.ENSP00000324204	0.690	Maturin
11	9606.ENSP00000222803	0.679	Peptidyl-prolyl cis-trans isomerase FKBP14
12	9606.ENSP00000344816	0.674	BSD domain containing 1
13	9606.ENSP00000397947	0.671	Pleckstrin homology domain-containing family A member 8
14	9606.ENSP00000301825	0.670	Ectonucleoside triphosphate diphosphohydrolase 3
15	9606.ENSP00000275428	0.668	Gamma-glutamylcyclotransferase
16	9606.ENSP00000357581	0.647	Homeobox protein Nkx-6.2
17	9606.ENSP00000378181	0.642	Bromodomain-containing protein 7
18	9606.ENSP00000369390	0.631	Cyclin-dependent kinase 14
19	9606.ENSP00000262498	0.623	Cilia- and flagella-associated protein 20
20	9606.ENSP00000310260	0.613	Integrator complex subunit 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	0.982	transcription coactivator activity
GO:0030695	0.979	GTPase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0051179	0.970	localization
GO:0048518	0.965	positive regulation of biological process
GO:0048522	0.956	positive regulation of cellular process
GO:0051171	0.950	regulation of nitrogen compound metabolic process
GO:0080090	0.949	regulation of primary metabolic process
GO:0060255	0.949	regulation of macromolecule metabolic process
GO:0031323	0.937	regulation of cellular metabolic process
GO:0033036	0.919	macromolecule localization
GO:0051641	0.916	cellular localization
GO:0009893	0.915	positive regulation of metabolic process
GO:0051246	0.911	regulation of protein metabolic process
GO:0051173	0.910	positive regulation of nitrogen compound metabolic process
GO:0033365	0.910	protein localization to organelle
GO:0010604	0.909	positive regulation of macromolecule metabolic process
GO:0007165	0.909	signal transduction
GO:0034504	0.869	protein localization to nucleus
GO:0051247	0.864	positive regulation of protein metabolic process
GO:0051457	0.852	maintenance of protein location in nucleus
GO:0031401	0.839	positive regulation of protein modification process
GO:0042325	0.832	regulation of phosphorylation
GO:0042509	0.799	regulation of tyrosine phosphorylation of STAT protein
GO:0050731	0.796	positive regulation of peptidyl-tyrosine phosphorylation
GO:0042531	0.714	positive regulation of tyrosine phosphorylation of STAT protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0070013	0.999	intracellular organelle lumen
GO:0005634	0.995	nucleus
GO:0005654	0.994	nucleoplasm
GO:0005829	0.990	cytosol
GO:0005739	0.780	mitochondrion
GO:0031975	0.616	envelope
GO:0031967	0.612	organelle envelope
GO:0005740	0.532	mitochondrial envelope
GO:0012505	0.384	endomembrane system
GO:0043232	0.349	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]