StarFunc result for job id Q9Y2Y6

User Input

>input (226 residues)
METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPS
ELELDDVVITNPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMK
TSASVSDIIVVAKRISPRVDDVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLT
GGLDWIDQSLSAAEEHLEVLREAALASEPDKGLPGPEGFLQEQSAI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91X86	0.707	0.707	8.831E-28	226	0.987	0.987	Q91X86.pdb.gz	TMM98_MOUSE Transmembrane protein 98 OS=Mus musculus OX=10090 GN=Tmem98 PE=1 SV=1
2	PDB:3ay5A	0.506	0.391	4.559E-4	298	0.137	0.104	3ay5A.pdb.gz
3	AFDB:O95273	0.463	0.297	4.343E-3	360	0.150	0.094	O95273.pdb.gz	CCDB1_HUMAN Cyclin-D1-binding protein 1 OS=Homo sapiens OX=9606 GN=CCNDBP1 PE=1 SV=2
4	AFDB:O94294	0.316	0.110	3.020E-2	886	0.106	0.027	O94294.pdb.gz	SOG2_SCHPO Leucine-rich repeat-containing protein sog2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sog2 PE=1 SV=1
5	AFDB:A3KNI7	0.473	0.319	3.898E-2	344	0.164	0.108	A3KNI7.pdb.gz	CCDB1_DANRE Cyclin-D1-binding protein 1 homolog OS=Danio rerio OX=7955 GN=ccndbp1 PE=2 SV=2
6	AFDB:Q08817	0.355	0.131	4.102E-2	791	0.115	0.033	Q08817.pdb.gz	SOG2_YEAST Leucine-rich repeat-containing protein SOG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SOG2 PE=1 SV=1
7	AFDB:G3V8Y8	0.482	0.124	1.082E-1	1030	0.102	0.022	G3V8Y8.pdb.gz	G3V8Y8_RAT Huntingtin interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Hip1 PE=3 SV=2
8	AFDB:A0A2R8QB02	0.476	0.120	1.627E-1	1056	0.084	0.018	A0A2R8QB02.pdb.gz
9	AFDB:F1MUI0	0.482	0.119	1.713E-1	1076	0.097	0.020	F1MUI0.pdb.gz	F1MUI0_BOVIN Huntingtin interacting protein 1 related OS=Bos taurus OX=9913 GN=HIP1R PE=1 SV=2
10	AFDB:Q9LYT5	0.360	0.181	1.713E-1	529	0.102	0.043	Q9LYT5.pdb.gz	PME35_ARATH Probable pectinesterase/pectinesterase inhibitor 35 OS=Arabidopsis thaliana OX=3702 GN=PME35 PE=2 SV=1
11	AFDB:Q02328	0.467	0.130	1.996E-1	927	0.102	0.025	Q02328.pdb.gz	SLAP2_CAEEL Huntington interacting protein related 1 OS=Caenorhabditis elegans OX=6239 GN=hipr-1 PE=3 SV=3
12	PDB:4eukB	0.210	0.297	3.297E-1	152	0.071	0.105	4eukB.pdb.gz	Structure-Function Analysis of Arabidopsis thaliana Histidine Kinase AHK5 Bound to Its Cognate Phosphotransfer Protein AHP1.
13	PDB:1wn0C	0.161	0.233	5.780E-1	138	0.097	0.159	1wn0C.pdb.gz
14	PDB:1rj1A	0.389	0.551	6.401E-1	148	0.049	0.074	1rj1A.pdb.gz
15	PDB:1yo7A	0.349	0.577	8.695E-1	120	0.080	0.150	1yo7A.pdb.gz	Structure of the ColE1 rop protein at 1.7 A resolution
16	PDB:1yviA	0.194	0.295	8.695E-1	140	0.062	0.100	1yviA.pdb.gz
17	PDB:6xz6A	0.136	0.139	9.150E-1	213	0.075	0.080	6xz6A.pdb.gz
18	PDB:7jpvE	0.309	0.429	1.181	139	0.075	0.122	7jpvE.pdb.gz	Structural Basis of the Modulation of the Voltage-Gated Calcium Ion Channel Ca v 1.1 by Dihydropyridine Compounds*.
19	PDB:7rycO	0.198	0.171	1.181	285	0.080	0.063	7rycO.pdb.gz	The oxytocin signaling complex reveals a molecular switch for cation dependence.
20	PDB:5mx5L	0.174	0.184	1.243	214	0.111	0.117	5mx5L.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2Y6	1.54e-165	457	226	1.000	1.000	TMM98_HUMAN Transmembrane protein 98 OS=Homo sapiens OX=9606 GN=TMEM98 PE=1 SV=1
2	Q91X86	2.10e-163	452	226	0.987	0.987	TMM98_MOUSE Transmembrane protein 98 OS=Mus musculus OX=10090 GN=Tmem98 PE=1 SV=1
3	O95273	1.87e-05	47.0	360	0.164	0.103	CCDB1_HUMAN Cyclin-D1-binding protein 1 OS=Homo sapiens OX=9606 GN=CCNDBP1 PE=1 SV=2
4	A3KNI7	4.19e-05	45.8	344	0.186	0.122	CCDB1_DANRE Cyclin-D1-binding protein 1 homolog OS=Danio rerio OX=7955 GN=ccndbp1 PE=2 SV=2
5	Q384P9	0.35	34.3	725	0.111	0.034	Q384P9_TRYB2 ATP-grasp domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5560 PE=4 SV=1
6	Q9SIT1	8.9	30.0	943	0.058	0.014	TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana OX=3702 GN=TMK3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15069 FAM163	1.1e+02	14.6	FAM163 family
2	PF13324 GCIP	0.00018	32.8	Grap2 and cyclin-D-interacting

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007308

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000009019	0.698	Membrane frizzled-related protein
2	61853.ENSNLEP00000021054	0.694	Rab9 effector protein with kelch motifs
3	61853.ENSNLEP00000017359	0.692	Protease, serine, 56
4	61853.ENSNLEP00000004727	0.637	Transmembrane protein 176A
5	61853.ENSNLEP00000003260	0.626	Myosin binding protein H-like
6	61853.ENSNLEP00000012262	0.622	Syntaxin 8
7	61853.ENSNLEP00000002112	0.582	Calpain 7
8	61853.ENSNLEP00000011769	0.559	Syntaxin 12
9	61853.ENSNLEP00000021941	0.559	Crumbs 1, cell polarity complex component
10	61853.ENSNLEP00000011167	0.553	RAB9A, member RAS oncogene family
11	61853.ENSNLEP00000015043	0.508	LCA5, lebercilin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0032879	0.952	regulation of localization
GO:0032501	0.920	multicellular organismal process
GO:0032502	0.902	developmental process
GO:0048856	0.894	anatomical structure development
GO:0050896	0.891	response to stimulus
GO:0060341	0.890	regulation of cellular localization
GO:0045321	0.885	leukocyte activation
GO:0006955	0.878	immune response
GO:0030097	0.878	hemopoiesis
GO:0046649	0.875	lymphocyte activation
GO:0051960	0.874	regulation of nervous system development
GO:0030217	0.870	T cell differentiation
GO:0035710	0.869	CD4-positive, alpha-beta T cell activation
GO:0002286	0.868	T cell activation involved in immune response
GO:0002292	0.864	T cell differentiation involved in immune response
GO:0048523	0.857	negative regulation of cellular process
GO:0045595	0.842	regulation of cell differentiation
GO:0019222	0.838	regulation of metabolic process
GO:0032880	0.828	regulation of protein localization
GO:0051093	0.730	negative regulation of developmental process
GO:0060284	0.721	regulation of cell development
GO:0051241	0.720	negative regulation of multicellular organismal process
GO:0051248	0.720	negative regulation of protein metabolic process
GO:0030162	0.719	regulation of proteolysis
GO:0045596	0.716	negative regulation of cell differentiation
GO:0050767	0.713	regulation of neurogenesis
GO:0002250	0.708	adaptive immune response
GO:0045685	0.707	regulation of glial cell differentiation
GO:0046632	0.707	alpha-beta T cell differentiation
GO:0031641	0.706	regulation of myelination
GO:0010721	0.705	negative regulation of cell development
GO:0043367	0.703	CD4-positive, alpha-beta T cell differentiation
GO:0002287	0.702	alpha-beta T cell activation involved in immune response
GO:0070613	0.701	regulation of protein processing
GO:0014013	0.701	regulation of gliogenesis
GO:0010629	0.689	negative regulation of gene expression
GO:0044057	0.669	regulation of system process
GO:1903318	0.669	negative regulation of protein maturation
GO:0048713	0.665	regulation of oligodendrocyte differentiation
GO:0031644	0.630	regulation of nervous system process
GO:1900180	0.630	regulation of protein localization to nucleus
GO:1900181	0.588	negative regulation of protein localization to nucleus
GO:0002460	0.581	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0048518	0.312	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005615	0.998	extracellular space
GO:0005783	0.998	endoplasmic reticulum
GO:0005886	0.992	plasma membrane
GO:0031982	0.973	vesicle
GO:0031090	0.932	organelle membrane
GO:0070062	0.892	extracellular exosome
GO:0031984	0.716	organelle subcompartment
GO:0005789	0.346	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]