StarFunc result for job id Q9Y2Y8

User Input

>input (225 residues)
MQCLLLLPFLLLGTVSALHLENDAPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAE
GEEVKASACQDNFEDEEAMESDPAALDKDFQCPREEDIVEVQGSPRCKICRYLLVRTPKT
FAEAQNVCSRCYGGNLVSIHDFNFNYRIQCCTSTVNQAQVWIGGNLRGWFLWKRFCWTDG
SHWNFAYWSPGQPGNGQGSCVALCTKGGYWRRAQCDKQLPFVCSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2Y8	1.000	1.000	1.033E-41	225	1.000	1.000	Q9Y2Y8.pdb.gz	PRG3_HUMAN Proteoglycan 3 OS=Homo sapiens OX=9606 GN=PRG3 PE=1 SV=2
2	AFDB:P13727	0.607	0.615	2.632E-24	222	0.498	0.505	P13727.pdb.gz	PRG2_HUMAN Bone marrow proteoglycan OS=Homo sapiens OX=9606 GN=PRG2 PE=1 SV=2
3	AFDB:Q61878	0.623	0.629	3.467E-23	223	0.458	0.462	Q61878.pdb.gz	PRG2_MOUSE Bone marrow proteoglycan OS=Mus musculus OX=10090 GN=Prg2 PE=1 SV=1
4	AFDB:P10758	0.491	0.658	3.498E-10	165	0.196	0.267	P10758.pdb.gz	LITH_RAT Lithostathine OS=Rattus norvegicus OX=10116 GN=Reg1 PE=1 SV=1
5	AFDB:P43137	0.489	0.656	3.933E-10	165	0.182	0.248	P43137.pdb.gz	LIT1_MOUSE Lithostathine-1 OS=Mus musculus OX=10090 GN=Reg1 PE=1 SV=1
6	AFDB:Q18821	0.490	0.655	7.492E-10	166	0.173	0.235	Q18821.pdb.gz	Q18821_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-86 PE=4 SV=1
7	AFDB:P05451	0.491	0.654	1.804E-9	166	0.178	0.241	P05451.pdb.gz	REG1A_HUMAN Lithostathine-1-alpha OS=Homo sapiens OX=9606 GN=REG1A PE=1 SV=3
8	AFDB:Q9XX56	0.491	0.688	2.151E-9	158	0.147	0.209	Q9XX56.pdb.gz	Q9XX56_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y38H6C.8 PE=1 SV=1
9	PDB:1qddA	0.488	0.740	4.517E-9	144	0.173	0.271	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
10	AFDB:Q3SXB8	0.448	0.375	4.886E-9	272	0.253	0.210	Q3SXB8.pdb.gz	COL11_MOUSE Collectin-11 OS=Mus musculus OX=10090 GN=Colec11 PE=2 SV=2
11	AFDB:Q61282	0.480	0.057	1.047E-8	2132	0.218	0.023	Q61282.pdb.gz	PGCA_MOUSE Aggrecan core protein OS=Mus musculus OX=10090 GN=Acan PE=1 SV=2
12	PDB:5f2qB	0.481	0.777	3.124E-8	135	0.160	0.267	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
13	PDB:7wz8A	0.432	0.530	1.611E-7	180	0.138	0.172	7wz8A.pdb.gz
14	PDB:4mthA	0.493	0.773	1.812E-7	139	0.138	0.223	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
15	PDB:1htnA	0.448	0.629	2.895E-7	156	0.124	0.179	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
16	PDB:1bj3A	0.382	0.634	6.201E-7	129	0.142	0.248	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
17	PDB:1gz2A	0.485	0.763	6.201E-7	139	0.111	0.180	1gz2A.pdb.gz
18	PDB:7jptA	0.411	0.080	1.328E-6	1327	0.142	0.024	7jptA.pdb.gz
19	PDB:7qsrA	0.459	0.084	1.584E-6	1335	0.120	0.020	7qsrA.pdb.gz
20	PDB:3bx4C	0.392	0.634	5.112E-6	134	0.120	0.201	3bx4C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2Y8	5.39e-170	468	225	1.000	1.000	PRG3_HUMAN Proteoglycan 3 OS=Homo sapiens OX=9606 GN=PRG3 PE=1 SV=2
2	P13727	8.74e-62	194	222	0.444	0.450	PRG2_HUMAN Bone marrow proteoglycan OS=Homo sapiens OX=9606 GN=PRG2 PE=1 SV=2
3	Q61878	3.02e-61	193	223	0.436	0.439	PRG2_MOUSE Bone marrow proteoglycan OS=Mus musculus OX=10090 GN=Prg2 PE=1 SV=1
4	P10758	4.16e-08	53.1	165	0.227	0.309	LITH_RAT Lithostathine OS=Rattus norvegicus OX=10116 GN=Reg1 PE=1 SV=1
5	Q17452	9.98e-08	53.5	308	0.173	0.127	Q17452_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-52 PE=1 SV=1
6	Q9UBG0	1.36e-07	53.9	1479	0.169	0.026	MRC2_HUMAN C-type mannose receptor 2 OS=Homo sapiens OX=9606 GN=MRC2 PE=1 SV=2
7	Q9XX56	1.51e-07	51.6	158	0.142	0.203	Q9XX56_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y38H6C.8 PE=1 SV=1
8	Q4TU93	1.99e-07	53.5	1480	0.164	0.025	MRC2_RAT C-type mannose receptor 2 OS=Rattus norvegicus OX=10116 GN=Mrc2 PE=1 SV=1
9	P06734	2.28e-07	52.8	321	0.173	0.121	FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor OS=Homo sapiens OX=9606 GN=FCER2 PE=1 SV=1
10	Q64449	2.67e-07	53.1	1479	0.164	0.025	MRC2_MOUSE C-type mannose receptor 2 OS=Mus musculus OX=10090 GN=Mrc2 PE=1 SV=3
11	Q4LDF5	6.17e-07	52.0	1732	0.151	0.020	Q4LDF5_CHICK DEC-205 protein OS=Gallus gallus OX=9031 GN=DEC205 PE=2 SV=1
12	P48304	2.06e-06	48.5	166	0.151	0.205	REG1B_HUMAN Lithostathine-1-beta OS=Homo sapiens OX=9606 GN=REG1B PE=1 SV=1
13	Q61830	2.30e-06	50.1	1456	0.196	0.030	MRC1_MOUSE Macrophage mannose receptor 1 OS=Mus musculus OX=10090 GN=Mrc1 PE=1 SV=2
14	Q08731	2.59e-06	48.1	173	0.169	0.220	LIT2_MOUSE Lithostathine-2 OS=Mus musculus OX=10090 GN=Reg2 PE=1 SV=1
15	P43137	3.00e-06	48.1	165	0.209	0.285	LIT1_MOUSE Lithostathine-1 OS=Mus musculus OX=10090 GN=Reg1 PE=1 SV=1
16	O60449	3.31e-06	49.7	1722	0.142	0.019	LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9606 GN=LY75 PE=1 SV=3
17	P20693	8.09e-06	48.1	331	0.169	0.115	FCER2_MOUSE Low affinity immunoglobulin epsilon Fc receptor OS=Mus musculus OX=10090 GN=Fcer2 PE=1 SV=1
18	Q800Z5	1.30e-05	46.2	173	0.169	0.220	Q800Z5_SALSA Lactose-binding lectin l-2 OS=Salmo salar OX=8030 GN=AJL2 PE=2 SV=1
19	P22897	1.82e-05	47.4	1456	0.191	0.030	MRC1_HUMAN Macrophage mannose receptor 1 OS=Homo sapiens OX=9606 GN=MRC1 PE=1 SV=1
20	Q61282	2.44e-05	47.0	2132	0.111	0.012	PGCA_MOUSE Aggrecan core protein OS=Mus musculus OX=10090 GN=Acan PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00059 Lectin_C	2.2e-07	42.9	Lectin C-type domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287143

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231454	0.578	Interleukin-5
2	9606.ENSP00000225371	0.577	Eosinophil peroxidase
3	9606.ENSP00000441354	0.519	Olfactory receptor 4D2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005201	1.000	extracellular matrix structural constituent
GO:0005515	0.996	protein binding
GO:0030021	0.571	extracellular matrix structural constituent conferring compression resistance
GO:0030246	0.569	carbohydrate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.987	regulation of biological process
GO:0048518	0.961	positive regulation of biological process
GO:0008152	0.934	metabolic process
GO:0050794	0.926	regulation of cellular process
GO:0010604	0.920	positive regulation of macromolecule metabolic process
GO:0051171	0.802	regulation of nitrogen compound metabolic process
GO:0080090	0.790	regulation of primary metabolic process
GO:0031323	0.787	regulation of cellular metabolic process
GO:0010605	0.787	negative regulation of macromolecule metabolic process
GO:0071704	0.727	organic substance metabolic process
GO:0010468	0.697	regulation of gene expression
GO:0001817	0.658	regulation of cytokine production
GO:0044237	0.656	cellular metabolic process
GO:0010629	0.641	negative regulation of gene expression
GO:0010628	0.633	positive regulation of gene expression
GO:0050896	0.534	response to stimulus
GO:0002376	0.487	immune system process
GO:0032501	0.399	multicellular organismal process
GO:0010556	0.320	regulation of macromolecule biosynthetic process
GO:0031326	0.317	regulation of cellular biosynthetic process
GO:0006807	0.316	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.997	cell periphery
GO:0005576	0.997	extracellular region
GO:0012505	0.996	endomembrane system
GO:0099503	0.995	secretory vesicle
GO:0070013	0.994	intracellular organelle lumen
GO:0030141	0.992	secretory granule
GO:0030312	0.976	external encapsulating structure
GO:0062023	0.961	collagen-containing extracellular matrix
GO:0060205	0.957	cytoplasmic vesicle lumen
GO:0005615	0.883	extracellular space
GO:0043230	0.869	extracellular organelle
GO:0034774	0.847	secretory granule lumen
GO:1903561	0.809	extracellular vesicle
GO:0042581	0.738	specific granule
GO:0070062	0.735	extracellular exosome
GO:0070820	0.427	tertiary granule
GO:1904724	0.412	tertiary granule lumen
GO:0035580	0.341	specific granule lumen
GO:0016020	0.339	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]