StarFunc result for job id Q9Y2Z9

User Input

>input (468 residues)
MAARLVSRCGAVRAAPHSGPLVSWRRWSGASTDTVYDVVVSGGGLVGAAMACALGYDIHF
HDKKILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQV
WDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLEAVSDRVTVLYRSKAIRYTWPCPF
PMADSSPWVHITLGDGSTFQTKLLIGADGHNSGVRQAVGIQNVSWNYDQSAVVATLHLSE
ATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEKFVDAVNSAFWSD
ADHTDFIDTAGAMLQYAVSLLKPTKVSARQLPPSVARVDAKSRVLFPLGLGHAAEYVRPR
VALIGDAAHRVHPLAGQGVNMGFGDISSLAHHLSTAAFNGKDLGSVSHLTGYETERQRHN
TALLAATDLLKRLYSTSASPLVLLRTWGLQATNAVSPLKEQIMAFASK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2Z9	1.000	1.000	9.481E-96	468	1.000	1.000	Q9Y2Z9.pdb.gz	COQ6_HUMAN Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Homo sapiens OX=9606 GN=COQ6 PE=1 SV=2
2	AFDB:Q8R1S0	0.938	0.922	1.398E-87	476	0.876	0.861	Q8R1S0.pdb.gz	COQ6_MOUSE Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Mus musculus OX=10090 GN=Coq6 PE=1 SV=3
3	AFDB:O01884	0.863	0.895	3.468E-53	451	0.374	0.388	O01884.pdb.gz	COQ6_CAEEL Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-6 PE=3 SV=2
4	AFDB:Q9Y7Z9	0.821	0.803	1.224E-45	479	0.327	0.319	Q9Y7Z9.pdb.gz	COQ6_SCHPO Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=coq6 PE=3 SV=2
5	AFDB:P53318	0.815	0.796	3.558E-42	479	0.306	0.299	P53318.pdb.gz	COQ6_YEAST Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ6 PE=1 SV=1
6	AFDB:P25535	0.780	0.908	6.257E-40	400	0.310	0.362	P25535.pdb.gz	UBII_ECOLI 2-octaprenylphenol hydroxylase OS=Escherichia coli (strain K12) OX=83333 GN=ubiI PE=1 SV=2
7	AFDB:P75728	0.751	0.895	1.219E-38	391	0.291	0.348	P75728.pdb.gz	UBIF_ECOLI 3-demethoxyubiquinol 3-hydroxylase OS=Escherichia coli (strain K12) OX=83333 GN=ubiF PE=1 SV=1
8	AFDB:P25534	0.767	0.911	6.098E-36	392	0.244	0.291	P25534.pdb.gz	UBIH_ECOLI 2-octaprenyl-6-methoxyphenol hydroxylase OS=Escherichia coli (strain K12) OX=83333 GN=ubiH PE=1 SV=2
9	AFDB:Q582J7	0.757	0.690	1.256E-34	515	0.254	0.231	Q582J7.pdb.gz	Q582J7_TRYB2 Monooxygenase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.130 PE=4 SV=1
10	PDB:4k22A	0.651	0.853	2.059E-33	354	0.280	0.370	4k22A.pdb.gz
11	AFDB:P77397	0.603	0.517	1.696E-23	554	0.165	0.139	P77397.pdb.gz	MHPA_ECOLI 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli (strain K12) OX=83333 GN=mhpA PE=1 SV=1
12	PDB:1d7lA	0.637	0.746	9.921E-21	394	0.156	0.185	1d7lA.pdb.gz	Structure-function correlations of the reaction of reduced nicotinamide analogues with p-hydroxybenzoate hydroxylase substituted with a series of 8-substituted flavins.
13	PDB:6lkeA	0.578	0.628	4.176E-19	428	0.154	0.168	6lkeA.pdb.gz	Full-length in meso structure and mechanism of rat kynurenine 3-monooxygenase inhibition.
14	PDB:5fn0A	0.572	0.587	4.412E-19	455	0.175	0.180	5fn0A.pdb.gz	Kynurenine-3-Monooxygenase Inhibition Prevents Multiple Organ Failure in Rodent Models of Acute Pancreatitis.
15	PDB:3ihgA	0.551	0.489	4.925E-19	535	0.171	0.150	3ihgA.pdb.gz	Structural basis for substrate recognition and specificity in aklavinone-11-hydroxylase from rhodomycin biosynthesis.
16	PDB:2dkiA	0.580	0.453	1.064E-18	615	0.156	0.119	2dkiA.pdb.gz	Crystal structure of 3-hydroxybenzoate hydroxylase from Comamonas testosteroni has a large tunnel for substrate and oxygen access to the active site
17	PDB:5dbjE	0.592	0.629	2.174E-18	437	0.167	0.178	5dbjE.pdb.gz	Crystal structure of halogenase PltA from the pyoluteorin biosynthetic pathway.
18	PDB:7on9A	0.643	0.754	2.564E-18	393	0.118	0.140	7on9A.pdb.gz	Debottlenecking 4-hydroxybenzoate hydroxylation in Pseudomonas putida KT2440 improves muconate productivity from p-coumarate.
19	PDB:3rp6A	0.634	0.744	3.768E-18	392	0.150	0.179	3rp6A.pdb.gz	Structural and Mechanistic Studies of HpxO, a Novel Flavin Adenine Dinucleotide-Dependent Urate Oxidase from Klebsiella pneumoniae.
20	PDB:3c96A	0.609	0.735	2.206E-16	381	0.143	0.176	3c96A.pdb.gz	Crystal structure of the flavin-containing monooxygenase phzS from Pseudomonas aeruginosa.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R1S0	0.0	822	476	0.876	0.861	COQ6_MOUSE Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Mus musculus OX=10090 GN=Coq6 PE=1 SV=3
2	Q9Y2Z9	0.0	962	468	1.000	1.000	COQ6_HUMAN Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Homo sapiens OX=9606 GN=COQ6 PE=1 SV=2
3	O01884	1.11e-103	318	451	0.380	0.395	COQ6_CAEEL Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-6 PE=3 SV=2
4	Q9Y7Z9	6.43e-70	231	479	0.338	0.330	COQ6_SCHPO Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=coq6 PE=3 SV=2
5	P53318	6.01e-67	224	479	0.321	0.313	COQ6_YEAST Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ6 PE=1 SV=1
6	P25535	4.58e-56	193	400	0.314	0.367	UBII_ECOLI 2-octaprenylphenol hydroxylase OS=Escherichia coli (strain K12) OX=83333 GN=ubiI PE=1 SV=2
7	P75728	3.58e-55	190	391	0.295	0.353	UBIF_ECOLI 3-demethoxyubiquinol 3-hydroxylase OS=Escherichia coli (strain K12) OX=83333 GN=ubiF PE=1 SV=1
8	P25534	2.14e-43	159	392	0.265	0.316	UBIH_ECOLI 2-octaprenyl-6-methoxyphenol hydroxylase OS=Escherichia coli (strain K12) OX=83333 GN=ubiH PE=1 SV=2
9	Q582J7	8.56e-27	115	515	0.239	0.217	Q582J7_TRYB2 Monooxygenase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.130 PE=4 SV=1
10	A7YJX0	1.69e-07	55.8	535	0.205	0.179	A7YJX0_9SPHN Octylphenol 4-monooxygenase OS=Sphingomonas sp. PWE1 OX=464102 GN=opdA PE=4 SV=1
11	Q6F6Y2	5.36e-04	44.7	385	0.137	0.166	HPXO_ACIAD FAD-dependent urate hydroxylase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=hpxO PE=1 SV=1
12	Q9I0Q0	0.001	43.5	382	0.126	0.154	PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pqsH PE=3 SV=1
13	P38169	0.005	41.6	460	0.205	0.209	KMO_YEAST Kynurenine 3-monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNA4 PE=1 SV=1
14	Q0JCU7	0.013	40.4	659	0.128	0.091	ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ZEP PE=2 SV=1
15	Q88FY2	0.014	40.0	382	0.124	0.152	6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=nicC PE=1 SV=1
16	G8BGH1	0.017	40.0	712	0.056	0.037	G8BGH1_CANPC Phenol 2-monooxygenase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=MNX3 PE=3 SV=1
17	Q8GYJ7	0.018	40.0	709	0.056	0.037	Q8GYJ7_ARATH FAD/NAD(P)-binding oxidoreductase family protein OS=Arabidopsis thaliana OX=3702 GN=EMB2421 PE=1 SV=1
18	A0A172J1S0	0.047	38.5	407	0.058	0.066	PHZS_LYSAN Phenazine 1,6-dicarboxylic acid hydroxylase PhzS OS=Lysobacter antibioticus OX=84531 GN=phzS PE=1 SV=1
19	Q5U913	0.051	38.5	541	0.043	0.037	Q5U913_STRVZ JadH OS=Streptomyces venezuelae OX=54571 GN=jadH PE=4 SV=1
20	Q1RLY6	0.058	38.1	474	0.094	0.093	KMO_DANRE Kynurenine 3-monooxygenase OS=Danio rerio OX=7955 GN=kmo PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01494 FAD_binding_3	2.5e-16	71.5	FAD binding domain
2	PF01627 Hpt	4.4e+02	12.5	Hpt domain
3	PF05834 Lycopene_cycl	1.7e+02	12.7	Lycopene cyclase protein
4	PF08491 SE	7.6	17.1	Squalene epoxidase
5	PF04820 Trp_halogenase	2e+02	12.2	Tryptophan halogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333946

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254759	0.999	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
2	9606.ENSP00000288532	0.997	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial
3	9606.ENSP00000310873	0.996	4-hydroxybenzoate polyprenyltransferase, mitochondrial
4	9606.ENSP00000322316	0.984	5-demethoxyubiquinone hydroxylase, mitochondrial
5	9606.ENSP00000315118	0.982	Atypical kinase COQ8B, mitochondrial
6	9606.ENSP00000262507	0.981	Ubiquinone biosynthesis protein COQ9, mitochondrial
7	9606.ENSP00000300452	0.973	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
8	9606.ENSP00000355741	0.969	Atypical kinase COQ8A, mitochondrial
9	9606.ENSP00000365388	0.950	Decaprenyl-diphosphate synthase subunit 1
10	9606.ENSP00000358033	0.943	Decaprenyl-diphosphate synthase subunit 2
11	9606.ENSP00000366006	0.938	UbiA prenyltransferase domain-containing protein 1
12	9606.ENSP00000238561	0.774	Uncharacterized aarF domain-containing protein kinase 1
13	9606.ENSP00000312587	0.742	Coenzyme Q-binding protein COQ10 homolog A, mitochondrial
14	9606.ENSP00000426638	0.734	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
15	9606.ENSP00000377311	0.724	Ferredoxin-2, mitochondrial
16	9606.ENSP00000310547	0.712	Uncharacterized aarF domain-containing protein kinase 5
17	9606.ENSP00000269321	0.707	Rho GDP-dissociation inhibitor 1
18	9606.ENSP00000416515	0.693	NADPH:adrenodoxin oxidoreductase, mitochondrial
19	9606.ENSP00000381490	0.688	La-related protein 4
20	9606.ENSP00000253413	0.671	V-type proton ATPase subunit E 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.994	catalytic activity
GO:0016491	0.928	oxidoreductase activity
GO:0016705	0.556	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497	0.368	monooxygenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006743	0.998	ubiquinone metabolic process
GO:1901576	0.945	organic substance biosynthetic process
GO:0042181	0.929	ketone biosynthetic process
GO:0006744	0.910	ubiquinone biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.960	membrane
GO:0032991	0.935	protein-containing complex
GO:0031090	0.915	organelle membrane
GO:0031967	0.861	organelle envelope
GO:0005740	0.749	mitochondrial envelope
GO:0019866	0.723	organelle inner membrane
GO:0031966	0.721	mitochondrial membrane
GO:0005743	0.714	mitochondrial inner membrane
GO:0070013	0.409	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.928	Oxidoreductases.
EC:1.14.-.-	0.556	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.

[back to server]