StarFunc result for job id Q9Y303

User Input

>input (409 residues)
MRGEQGAAGARVLQFTNCRILRGGKLLREDLWVRGGRILDPEKLFFEERRVADERRDCGG
RILAPGFIDVQINGGFGVDFSQATEDVGSGVALVARRILSHGVTSFCPTLVTSPPEVYHK
VVPQIPVKSGGPHGAGVLGLHLEGPFISREKRGAHPEAHLRSFEADAFQDLLATYGPLDN
VRIVTLAPELGRSHEVIRALTARGICVSLGHSVADLRAAEDAVWSGATFITHLFNAMLPF
HHRDPGIVGLLTSDRLPAGRCIFYGMIADGTHTNPAALRIAHRAHPQGLVLVTDAIPALG
LGNGRHTLGQQEVEVDGLTAYVAGTKTLSGSIAPMDVCVRHFLQATGCSMESALEAASLH
PAQLLGLEKSKGTLDFGADADFVVLDDSLHVQATYISGELVWQADAARQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8JZV7	0.994	0.994	2.967E-87	409	0.907	0.907	Q8JZV7.pdb.gz	NAGA_MOUSE N-acetylglucosamine-6-phosphate deacetylase OS=Mus musculus OX=10090 GN=Amdhd2 PE=1 SV=1
2	PDB:7nutA	0.974	0.993	5.741E-84	401	0.980	1.000	7nutA.pdb.gz	GFPT2/GFAT2 and AMDHD2 act in tandem to control the hexosamine pathway.
3	AFDB:A0A1D8PQG3	0.891	0.883	3.275E-45	413	0.359	0.356	A0A1D8PQG3.pdb.gz	A0A1D8PQG3_CANAL N-acetylglucosamine-6-phosphate deacetylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DAC1 PE=3 SV=1
4	AFDB:O34450	0.868	0.895	1.159E-41	396	0.318	0.328	O34450.pdb.gz	NAGA_BACSU N-acetylglucosamine-6-phosphate deacetylase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagA PE=1 SV=1
5	PDB:2vhlB	0.866	0.899	3.885E-40	393	0.315	0.328	2vhlB.pdb.gz	The Three-Dimensional Structure of the N-Acetylglucosamine-6-Phosphate Deacetylase from Bacillus Subtilis
6	AFDB:A0KYQ5	0.843	0.873	2.369E-36	394	0.315	0.327	A0KYQ5.pdb.gz	AGAA2_SHESA N-acetylgalactosamine-6-phosphate deacetylase OS=Shewanella sp. (strain ANA-3) OX=94122 GN=agaAII PE=1 SV=1
7	AFDB:P0AF18	0.841	0.898	4.846E-36	382	0.315	0.338	P0AF18.pdb.gz	NAGA_ECOLI N-acetylglucosamine-6-phosphate deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=nagA PE=1 SV=1
8	PDB:2p50A	0.829	0.885	4.642E-35	382	0.318	0.340	2p50A.pdb.gz	Structural Diversity within the Mononuclear and Binuclear Active Sites of N-Acetyl-d-glucosamine-6-phosphate Deacetylase.
9	PDB:2p50B	0.768	0.877	5.483E-33	356	0.303	0.348	2p50B.pdb.gz	Structural Diversity within the Mononuclear and Binuclear Active Sites of N-Acetyl-d-glucosamine-6-phosphate Deacetylase.
10	AFDB:O51175	0.832	0.848	1.434E-32	401	0.264	0.269	O51175.pdb.gz	O51175_BORBU N-acetylglucosamine-6-phosphate deacetylase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=nagA PE=3 SV=1
11	PDB:1yrrB	0.722	0.876	4.369E-30	334	0.293	0.359	1yrrB.pdb.gz	Structural analysis of N-acetylglucosamine-6-phosphate deacetylase apoenzyme from Escherichia coli.
12	AFDB:Q9HU91	0.609	0.618	1.668E-13	402	0.203	0.206	Q9HU91.pdb.gz	HUTI_PSEAE Imidazolonepropionase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=hutI PE=3 SV=1
13	AFDB:P39377	0.482	0.500	3.029E-13	390	0.186	0.195	P39377.pdb.gz	IADA_ECOLI Isoaspartyl dipeptidase OS=Escherichia coli (strain K12) OX=83333 GN=iadA PE=1 SV=1
14	AFDB:Q72EX7	0.468	0.347	3.846E-13	575	0.213	0.151	Q72EX7.pdb.gz	ADEC_DESVH Adenine deaminase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=ade PE=1 SV=1
15	PDB:1onxA	0.476	0.496	8.291E-13	389	0.186	0.195	1onxA.pdb.gz	High Resolution X-ray Structure of Isoaspartyl Dipeptidase from Escherichia coli
16	AFDB:O53619	0.587	0.584	1.194E-12	411	0.178	0.178	O53619.pdb.gz	O53619_MYCTU Conserved protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0074 PE=1 SV=1
17	PDB:2vunA	0.590	0.623	2.153E-12	385	0.147	0.156	2vunA.pdb.gz	The Crystal Structure of Enamidase: A Bifunctional Enzyme of the Nicotinate Catabolism.
18	PDB:3e74B	0.554	0.527	4.405E-12	433	0.159	0.150	3e74B.pdb.gz	Crystal structure of metal-dependent allantoinase from Escherichia coli
19	PDB:4cnuA	0.548	0.470	5.592E-12	488	0.174	0.145	4cnuA.pdb.gz
20	PDB:4b3zD	0.560	0.490	6.300E-12	477	0.174	0.149	4b3zD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8JZV7	0.0	751	409	0.907	0.907	NAGA_MOUSE N-acetylglucosamine-6-phosphate deacetylase OS=Mus musculus OX=10090 GN=Amdhd2 PE=1 SV=1
2	Q9Y303	0.0	825	409	1.000	1.000	NAGA_HUMAN N-acetylglucosamine-6-phosphate deacetylase OS=Homo sapiens OX=9606 GN=AMDHD2 PE=1 SV=2
3	A0A1D8PQG3	9.67e-76	243	413	0.372	0.368	A0A1D8PQG3_CANAL N-acetylglucosamine-6-phosphate deacetylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DAC1 PE=3 SV=1
4	O34450	8.85e-57	193	396	0.311	0.321	NAGA_BACSU N-acetylglucosamine-6-phosphate deacetylase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagA PE=1 SV=1
5	P0AF18	1.60e-48	171	382	0.308	0.330	NAGA_ECOLI N-acetylglucosamine-6-phosphate deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=nagA PE=1 SV=1
6	A0KYQ5	7.37e-43	156	394	0.298	0.310	AGAA2_SHESA N-acetylgalactosamine-6-phosphate deacetylase OS=Shewanella sp. (strain ANA-3) OX=94122 GN=agaAII PE=1 SV=1
7	O51175	8.40e-36	137	401	0.274	0.279	O51175_BORBU N-acetylglucosamine-6-phosphate deacetylase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=nagA PE=3 SV=1
8	D2KKE6	3.38e-12	66.2	153	0.137	0.366	D2KKE6_KOMXY Putative N-acetylglucosamine-6-phosphate deacetylase (Fragment) OS=Komagataeibacter xylinus OX=28448 PE=4 SV=1
9	Q9HU91	0.22	36.2	402	0.049	0.050	HUTI_PSEAE Imidazolonepropionase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=hutI PE=3 SV=1
10	Q9HT33	0.38	35.4	445	0.086	0.079	Q9HT33_PSEAE Dihydroorotase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pyrQ PE=3 SV=1
11	Q9HZ64	0.80	34.3	444	0.056	0.052	Q9HZ64_PSEAE Amidohydrolase-related domain-containing protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA3170 PE=1 SV=1
12	Q93VR9	1.1	33.9	326	0.061	0.077	SEH1_ARATH Protein SEH1 OS=Arabidopsis thaliana OX=3702 GN=SEH1 PE=1 SV=1
13	Q9ESS2	1.3	32.7	162	0.046	0.117	FGF22_MOUSE Fibroblast growth factor 22 OS=Mus musculus OX=10090 GN=Fgf22 PE=2 SV=1
14	A0A384JQG4	2.6	32.7	509	0.037	0.029	ABA1_BOTFB Cytochrome P450 monooxygenase aba1 OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=aba1 PE=2 SV=1
15	Q03169	2.6	32.7	654	0.046	0.029	TNAP2_HUMAN Tumor necrosis factor alpha-induced protein 2 OS=Homo sapiens OX=9606 GN=TNFAIP2 PE=1 SV=2
16	Q6H9H9	2.6	32.7	509	0.037	0.029	ABA1_BOTFU Cytochrome P450 monooxygenase aba1 OS=Botryotinia fuckeliana OX=40559 GN=aba1 PE=2 SV=2
17	Q9CB03	3.3	32.3	694	0.088	0.052	NPGR1_ARATH Protein NPGR1 OS=Arabidopsis thaliana OX=3702 GN=NPGR1 PE=1 SV=1
18	O32164	3.4	32.3	406	0.073	0.074	SUFS_BACSU Cysteine desulfurase SufS OS=Bacillus subtilis (strain 168) OX=224308 GN=sufS PE=1 SV=1
19	Q5B4C7	3.8	32.3	506	0.039	0.032	Q5B4C7_EMENI Allantoinase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04603 PE=4 SV=1
20	Q9CR48	4.5	31.6	267	0.034	0.052	DRAM2_MOUSE DNA damage-regulated autophagy modulator protein 2 OS=Mus musculus OX=10090 GN=Dram2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01979 Amidohydro_1	2e-12	58.7	Amidohydrolase family
2	PF07969 Amidohydro_3	2.7e-06	38.8	Amidohydrolase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000006715

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000013167	0.994	Glucosamine-6-phosphate deaminase 2
2	60711.ENSCSAP00000008586	0.991	Glucosamine-6-phosphate deaminase 1
3	60711.ENSCSAP00000011331	0.970	N-acetylglucosamine kinase
4	60711.ENSCSAP00000013422	0.874	Catalyzes the conversion of GlcNAc-6-P into GlcNAc-1-P during the synthesis of uridine diphosphate/UDP-GlcNAc, a sugar nucleotide critical to multiple glycosylation pathways including protein N- and O- glycosylation
5	60711.ENSCSAP00000006921	0.831	Glucosamine (UDP-N-acetyl)-2-epimerase/N-acetylmannosamine kinase
6	60711.ENSCSAP00000006296	0.830	Glucokinase (hexokinase 4) regulator
7	60711.ENSCSAP00000017240	0.790	Hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
8	60711.ENSCSAP00000004432	0.766	Glutamine-fructose-6-phosphate transaminase 2
9	60711.ENSCSAP00000011092	0.766	Glutamine--fructose-6-phosphate transaminase 1
10	60711.ENSCSAP00000008461	0.724	Converts alpha-aldose to the beta-anomer.
11	60711.ENSCSAP00000008442	0.661	ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
12	60711.ENSCSAP00000019148	0.659	Myeloid-associated differentiation marker
13	60711.ENSCSAP00000001874	0.646	Hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.
14	60711.ENSCSAP00000008343	0.635	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2.
15	60711.ENSCSAP00000004654	0.629	Tumor protein p53 inducible protein 3
16	60711.ENSCSAP00000007202	0.601	N-acetylneuraminic acid synthase
17	60711.ENSCSAP00000000370	0.560	Phosphoglucomutase 2-like 1
18	60711.ENSCSAP00000012896	0.560	Phosphoglucomutase 2
19	60711.ENSCSAP00000007816	0.559	Rho GTPase activating protein 12
20	60711.ENSCSAP00000009944	0.558	Zinc finger and BTB domain containing 25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008448	1.000	N-acetylglucosamine-6-phosphate deacetylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0046348	0.994	amino sugar catabolic process
GO:0046395	0.990	carboxylic acid catabolic process
GO:0043603	0.987	amide metabolic process
GO:1901565	0.983	organonitrogen compound catabolic process
GO:0044238	0.638	primary metabolic process
GO:1901360	0.459	organic cyclic compound metabolic process
GO:0055086	0.428	nucleobase-containing small molecule metabolic process
GO:0006793	0.424	phosphorus metabolic process
GO:1901137	0.337	carbohydrate derivative biosynthetic process
GO:0034654	0.310	nucleobase-containing compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	0.998	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22936	1.000	H2O + N-acetyl-D-glucosamine 6-phosphate = acetate + D-glucosamine 6-phosphate
EC:3.5.1.25	1.000	N-acetylglucosamine-6-phosphate deacetylase.

[back to server]