StarFunc result for job id Q9Y315

User Input

>input (318 residues)
MSAHNRGTELDLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLS
GDDTSSNIQRLCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNI
PVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRK
ACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAI
RDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQ
IYHHVTGRYAAYHDLPMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y315	1.000	1.000	2.397E-60	318	1.000	1.000	Q9Y315.pdb.gz	DEOC_HUMAN Deoxyribose-phosphate aldolase OS=Homo sapiens OX=9606 GN=DERA PE=1 SV=2
2	AFDB:E9PPM8	0.849	0.980	7.123E-44	275	0.865	1.000	E9PPM8.pdb.gz	E9PPM8_HUMAN deoxyribose-phosphate aldolase OS=Homo sapiens OX=9606 GN=DERA PE=1 SV=1
3	AFDB:E9PML7	0.654	0.876	3.181E-32	236	0.645	0.869	E9PML7.pdb.gz	E9PML7_HUMAN deoxyribose-phosphate aldolase (Fragment) OS=Homo sapiens OX=9606 GN=DERA PE=1 SV=1
4	PDB:1jcjA	0.744	0.931	4.450E-23	252	0.305	0.385	1jcjA.pdb.gz	Observation of covalent intermediates in an enzyme mechanism at atomic resolution.
5	AFDB:P0A6L0	0.736	0.898	8.689E-23	259	0.314	0.386	P0A6L0.pdb.gz	DEOC_ECOLI Deoxyribose-phosphate aldolase OS=Escherichia coli (strain K12) OX=83333 GN=deoC PE=1 SV=1
6	AFDB:Q582I3	0.616	0.694	1.446E-16	280	0.255	0.289	Q582I3.pdb.gz	Q582I3_TRYB2 deoxyribose-phosphate aldolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.320 PE=3 SV=1
7	PDB:1n7kA	0.615	0.818	4.904E-13	234	0.192	0.261	1n7kA.pdb.gz
8	AFDB:Q9Y948	0.588	0.782	8.153E-13	235	0.198	0.268	Q9Y948.pdb.gz	DEOC_AERPE Deoxyribose-phosphate aldolase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) OX=272557 GN=deoC PE=1 SV=2
9	PDB:4tr9A	0.415	0.388	1.646E-5	347	0.142	0.130	4tr9A.pdb.gz	Inhibition by stabilization: targeting the Plasmodium falciparum aldolase-TRAP complex.
10	AFDB:P0ACB2	0.434	0.428	1.781E-5	324	0.138	0.136	P0ACB2.pdb.gz	HEM2_ECOLI Delta-aminolevulinic acid dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=hemB PE=1 SV=2
11	AFDB:Q9NTM9	0.410	0.465	2.736E-5	273	0.104	0.121	Q9NTM9.pdb.gz	CUTC_HUMAN Copper homeostasis protein cutC homolog OS=Homo sapiens OX=9606 GN=CUTC PE=1 SV=1
12	AFDB:P9WHL1	0.447	0.406	3.578E-5	357	0.142	0.126	P9WHL1.pdb.gz	PYRD_MYCTU Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pyrD PE=1 SV=1
13	AFDB:P75089	0.424	0.460	3.983E-5	288	0.101	0.111	P75089.pdb.gz	ALF_MYCPN Fructose-bisphosphate aldolase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=fba PE=3 SV=1
14	PDB:1b4eA	0.406	0.401	4.323E-5	323	0.154	0.152	1b4eA.pdb.gz	X-ray structure of 5-aminolevulinic acid dehydratase from Escherichia coli complexed with the inhibitor levulinic acid at 2.0 A resolution.
15	PDB:1xfbA	0.376	0.355	7.392E-5	342	0.135	0.126	1xfbA.pdb.gz
16	PDB:7r4pA	0.372	0.353	8.230E-5	337	0.126	0.119	7r4pA.pdb.gz	Structure of human hydroxyacid oxidase 1 bound with 5-bromo-N-methyl-1H-indazole-3-carboxamide
17	PDB:3q45A	0.432	0.384	9.162E-5	368	0.094	0.082	3q45A.pdb.gz	Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
18	PDB:1oqfA	0.375	0.405	1.135E-4	290	0.101	0.110	1oqfA.pdb.gz
19	PDB:3b0vC	0.423	0.427	1.653E-4	315	0.119	0.121	3b0vC.pdb.gz	Molecular basis of dihydrouridine formation on tRNA
20	PDB:1f76A	0.383	0.366	1.744E-4	336	0.091	0.086	1f76A.pdb.gz	E. coli Dihydroorotate Dehydrogenase Reveals Structural and Functional Distinction between different classes of dihydroorotate dehydrogenases

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PPM8	0.0	550	275	0.865	1.000	E9PPM8_HUMAN deoxyribose-phosphate aldolase OS=Homo sapiens OX=9606 GN=DERA PE=1 SV=1
2	Q9Y315	0.0	658	318	1.000	1.000	DEOC_HUMAN Deoxyribose-phosphate aldolase OS=Homo sapiens OX=9606 GN=DERA PE=1 SV=2
3	E9PML7	1.58e-153	431	236	0.676	0.911	E9PML7_HUMAN deoxyribose-phosphate aldolase (Fragment) OS=Homo sapiens OX=9606 GN=DERA PE=1 SV=1
4	P0A6L0	6.67e-41	145	259	0.296	0.363	DEOC_ECOLI Deoxyribose-phosphate aldolase OS=Escherichia coli (strain K12) OX=83333 GN=deoC PE=1 SV=1
5	Q582I3	3.43e-16	79.3	280	0.217	0.246	Q582I3_TRYB2 deoxyribose-phosphate aldolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.320 PE=3 SV=1
6	Q9Y948	3.38e-08	55.5	235	0.208	0.281	DEOC_AERPE Deoxyribose-phosphate aldolase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) OX=272557 GN=deoC PE=1 SV=2
7	Q70EL1	3.3	32.0	1684	0.091	0.017	UBP54_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 54 OS=Homo sapiens OX=9606 GN=USP54 PE=1 SV=4
8	Q2VJ58	5.8	30.4	161	0.082	0.161	Q2VJ58_STRPY Immunity factor for SPN OS=Streptococcus pyogenes OX=1314 GN=ifs PE=1 SV=1
9	Q8BIL5	7.2	30.8	728	0.050	0.022	HOOK1_MOUSE Protein Hook homolog 1 OS=Mus musculus OX=10090 GN=Hook1 PE=1 SV=2
10	D3ZB48	7.5	30.8	728	0.050	0.022	D3ZB48_RAT Hook microtubule-tethering protein 1 OS=Rattus norvegicus OX=10116 GN=Hook1 PE=1 SV=1
11	A0A8I6AX65	7.6	30.8	732	0.050	0.022	A0A8I6AX65_RAT Hook microtubule-tethering protein 1 OS=Rattus norvegicus OX=10116 GN=Hook1 PE=1 SV=1
12	F2XFA6	9.9	30.4	627	0.072	0.037	LLOS1_PICSI (R)-linalool synthase 1, chloroplastic OS=Picea sitchensis OX=3332 GN=TPS-Lin-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01791 DeoC	2.9e-26	104.0	DeoC/LacD family aldolase
2	PF08295 Sin3_corepress	5.8e+02	11.9	Sin3 family co-repressor
3	PF20028 VMAP-C	1.7	20.0	vWA-MoxR associated protein C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416583

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229270	0.982	Triosephosphate isomerase 1
2	9606.ENSP00000280605	0.960	Transketolase-like protein 2
3	9606.ENSP00000306817	0.960	Ribokinase
4	9606.ENSP00000371393	0.959	Phosphoglucomutase-2
5	9606.ENSP00000391481	0.957	Transketolase
6	9606.ENSP00000321259	0.955	Transaldolase
7	9606.ENSP00000358931	0.952	Transketolase-like protein 1
8	9606.ENSP00000293350	0.930	Aldehyde dehydrogenase 16 family member A1
9	9606.ENSP00000363988	0.930	Belongs to the class I fructose-bisphosphate aldolase family
10	9606.ENSP00000378669	0.922	Fructose-bisphosphate aldolase A
11	9606.ENSP00000255084	0.916	Aldehyde dehydrogenase family 3 member B2
12	9606.ENSP00000366927	0.916	Aldehyde dehydrogenase X, mitochondrial
13	9606.ENSP00000411821	0.916	Aldehyde dehydrogenase, dimeric NADP-preferring
14	9606.ENSP00000473990	0.916	Aldehyde dehydrogenase family 3 member B1
15	9606.ENSP00000226253	0.912	Belongs to the class I fructose-bisphosphate aldolase family
16	9606.ENSP00000405573	0.885	Glucose-6-phosphate isomerase
17	9606.ENSP00000346643	0.858	Putative hexokinase HKDC1
18	9606.ENSP00000234590	0.851	Alpha-enolase
19	9606.ENSP00000313921	0.846	Mitochondrial peptide methionine sulfoxide reductase
20	9606.ENSP00000376840	0.845	Bisphosphoglycerate mutase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004139	0.999	deoxyribose-phosphate aldolase activity
GO:0042802	0.536	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:1901565	0.986	organonitrogen compound catabolic process
GO:0044282	0.985	small molecule catabolic process
GO:0006091	0.984	generation of precursor metabolites and energy
GO:0006163	0.983	purine nucleotide metabolic process
GO:1901361	0.981	organic cyclic compound catabolic process
GO:1901657	0.974	glycosyl compound metabolic process
GO:0034655	0.970	nucleobase-containing compound catabolic process
GO:1901136	0.961	carbohydrate derivative catabolic process
GO:0051156	0.956	glucose 6-phosphate metabolic process
GO:0046496	0.956	nicotinamide nucleotide metabolic process
GO:0006740	0.937	NADPH regeneration
GO:0034656	0.933	nucleobase-containing small molecule catabolic process
GO:0009116	0.929	nucleoside metabolic process
GO:0006098	0.893	pentose-phosphate shunt
GO:0009164	0.889	nucleoside catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0005654	0.997	nucleoplasm
GO:0005576	0.984	extracellular region
GO:0012505	0.982	endomembrane system
GO:0031982	0.952	vesicle
GO:0065010	0.754	extracellular membrane-bounded organelle
GO:1903561	0.740	extracellular vesicle
GO:0031410	0.727	cytoplasmic vesicle
GO:0099503	0.724	secretory vesicle
GO:0005615	0.720	extracellular space
GO:0070062	0.702	extracellular exosome
GO:0031983	0.696	vesicle lumen
GO:0060205	0.687	cytoplasmic vesicle lumen
GO:0030141	0.642	secretory granule
GO:0034774	0.619	secretory granule lumen
GO:1904813	0.586	ficolin-1-rich granule lumen
GO:0016020	0.320	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12821	0.999	2-deoxy-D-ribose 5-phosphate = acetaldehyde + D-glyceraldehyde 3-phosphate
EC:4.1.2.4	0.999	deoxyribose-phosphate aldolase.

[back to server]