StarFunc result for job id Q9Y333

User Input

>input (95 residues)
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNC
FIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35900	0.998	0.998	1.453E-18	95	1.000	1.000	O35900.pdb.gz	LSM2_MOUSE U6 snRNA-associated Sm-like protein LSm2 OS=Mus musculus OX=10090 GN=Lsm2 PE=1 SV=1
2	PDB:6qw662	0.948	0.948	1.047E-16	95	1.000	1.000	6qw662.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
3	AFDB:Q1H595	0.931	0.951	1.461E-15	93	0.716	0.731	Q1H595.pdb.gz	LSM2_ARATH Sm-like protein LSM2 OS=Arabidopsis thaliana OX=3702 GN=LSM2 PE=1 SV=1
4	AFDB:P38203	0.963	0.963	4.096E-14	95	0.632	0.632	P38203.pdb.gz	LSM2_YEAST U6 snRNA-associated Sm-like protein LSm2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSM2 PE=1 SV=1
5	AFDB:O94408	0.976	0.966	9.139E-14	96	0.611	0.604	O94408.pdb.gz	LSM2_SCHPO U6 snRNA-associated Sm-like protein LSm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm2 PE=1 SV=1
6	PDB:6ppnB	0.940	0.949	4.093E-13	94	0.600	0.606	6ppnB.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
7	PDB:4c92B	0.885	0.806	1.469E-11	105	0.611	0.552	4c92B.pdb.gz
8	AFDB:Q9VKW8	0.687	0.441	2.641E-7	154	0.295	0.182	Q9VKW8.pdb.gz	Q9VKW8_DROME U6 snRNA-associated Sm-like protein LSm4 OS=Drosophila melanogaster OX=7227 GN=CG5356 PE=1 SV=3
9	PDB:3jcr4	0.706	0.828	4.405E-7	80	0.284	0.338	3jcr4.pdb.gz
10	AFDB:Q9Y4Z0	0.671	0.470	8.022E-7	139	0.263	0.180	Q9Y4Z0.pdb.gz	LSM4_HUMAN U6 snRNA-associated Sm-like protein LSm4 OS=Homo sapiens OX=9606 GN=LSM4 PE=1 SV=1
11	AFDB:Q19952	0.671	0.528	1.027E-6	123	0.274	0.211	Q19952.pdb.gz	LSM4_CAEEL Probable U6 snRNA-associated Sm-like protein LSm4 OS=Caenorhabditis elegans OX=6239 GN=lsm-4 PE=3 SV=1
12	PDB:5nrll	0.713	0.687	1.112E-6	99	0.316	0.303	5nrll.pdb.gz	Structure of a pre-catalytic spliceosome.
13	AFDB:P40070	0.659	0.346	1.314E-6	187	0.200	0.102	P40070.pdb.gz	LSM4_YEAST U6 snRNA-associated Sm-like protein LSm4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSM4 PE=1 SV=1
14	PDB:3jcmh	0.697	0.846	1.338E-6	77	0.211	0.260	3jcmh.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
15	PDB:6ppnD	0.656	0.705	1.423E-6	88	0.263	0.284	6ppnD.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
16	AFDB:O14352	0.682	0.545	1.790E-6	121	0.253	0.198	O14352.pdb.gz	LSM4_SCHPO Probable U6 snRNA-associated Sm-like protein LSm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm4 PE=1 SV=1
17	AFDB:Q02260	0.643	0.425	2.154E-6	146	0.284	0.185	Q02260.pdb.gz	SMD1_YEAST Small nuclear ribonucleoprotein Sm D1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMD1 PE=1 SV=1
18	PDB:6qw666	0.599	0.770	2.639E-6	72	0.211	0.278	6qw666.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	PDB:3jb9D	0.683	0.676	5.534E-6	96	0.221	0.219	3jb9D.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
20	PDB:6v4xC	0.664	0.561	7.535E-6	114	0.221	0.184	6v4xC.pdb.gz	Structure of an active human histone pre-mRNA 3'-end processing machinery.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35900	2.60e-66	196	95	1.000	1.000	LSM2_MOUSE U6 snRNA-associated Sm-like protein LSm2 OS=Mus musculus OX=10090 GN=Lsm2 PE=1 SV=1
2	Q9Y333	2.60e-66	196	95	1.000	1.000	LSM2_HUMAN U6 snRNA-associated Sm-like protein LSm2 OS=Homo sapiens OX=9606 GN=LSM2 PE=1 SV=1
3	Q9VTW6	5.52e-61	182	95	0.916	0.916	Q9VTW6_DROME U6 snRNA-associated Sm-like protein LSm2 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10418 PE=1 SV=1
4	Q1H595	4.98e-46	144	93	0.716	0.731	LSM2_ARATH Sm-like protein LSM2 OS=Arabidopsis thaliana OX=3702 GN=LSM2 PE=1 SV=1
5	P38203	1.84e-39	128	95	0.632	0.632	LSM2_YEAST U6 snRNA-associated Sm-like protein LSm2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSM2 PE=1 SV=1
6	O94408	5.48e-37	122	96	0.611	0.604	LSM2_SCHPO U6 snRNA-associated Sm-like protein LSm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm2 PE=1 SV=1
7	D4A2C6	2.01e-09	52.8	138	0.326	0.225	D4A2C6_RAT U6 snRNA-associated Sm-like protein LSm4 OS=Rattus norvegicus OX=10116 GN=Lsm4 PE=3 SV=1
8	Q9VKW8	2.11e-09	53.1	154	0.347	0.214	Q9VKW8_DROME U6 snRNA-associated Sm-like protein LSm4 OS=Drosophila melanogaster OX=7227 GN=CG5356 PE=1 SV=3
9	Q9Y4Z0	1.29e-08	50.8	139	0.295	0.201	LSM4_HUMAN U6 snRNA-associated Sm-like protein LSm4 OS=Homo sapiens OX=9606 GN=LSM4 PE=1 SV=1
10	A0A8I6APJ0	1.66e-08	50.8	146	0.316	0.205	A0A8I6APJ0_RAT U6 snRNA-associated Sm-like protein LSm4 OS=Rattus norvegicus OX=10116 GN=Lsm4 PE=1 SV=1
11	O14352	2.85e-08	49.7	121	0.274	0.215	LSM4_SCHPO Probable U6 snRNA-associated Sm-like protein LSm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm4 PE=1 SV=1
12	F4K4E3	3.79e-08	49.3	129	0.305	0.225	LSM4_ARATH Sm-like protein LSM4 OS=Arabidopsis thaliana OX=3702 GN=LSM4 PE=1 SV=1
13	Q10013	9.17e-08	48.5	126	0.326	0.246	SMD1_CAEEL Probable small nuclear ribonucleoprotein Sm D1 OS=Caenorhabditis elegans OX=6239 GN=snr-3 PE=3 SV=1
14	Q8QZX5	1.72e-07	47.4	122	0.242	0.189	LSM10_MOUSE U7 snRNA-associated Sm-like protein LSm10 OS=Mus musculus OX=10090 GN=Lsm10 PE=1 SV=1
15	Q969L4	2.68e-07	47.0	123	0.221	0.171	LSM10_HUMAN U7 snRNA-associated Sm-like protein LSm10 OS=Homo sapiens OX=9606 GN=LSM10 PE=1 SV=1
16	O42661	1.05e-06	45.4	117	0.305	0.248	SMD1_SCHPO Small nuclear ribonucleoprotein Sm D1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smd1 PE=1 SV=1
17	Q19952	2.06e-06	44.7	123	0.253	0.195	LSM4_CAEEL Probable U6 snRNA-associated Sm-like protein LSm4 OS=Caenorhabditis elegans OX=6239 GN=lsm-4 PE=3 SV=1
18	Q02260	7.02e-06	43.9	146	0.211	0.137	SMD1_YEAST Small nuclear ribonucleoprotein Sm D1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMD1 PE=1 SV=1
19	Q9SY09	3.78e-05	41.2	116	0.284	0.233	SMD1B_ARATH Small nuclear ribonucleoprotein SmD1b OS=Arabidopsis thaliana OX=3702 GN=SMD1B PE=3 SV=1
20	Q9VU02	4.01e-05	41.2	124	0.284	0.218	SMD1_DROME Probable small nuclear ribonucleoprotein Sm D1 OS=Drosophila melanogaster OX=7227 GN=SmD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14432 DYW_deaminase	3.5e+02	12.4	DYW family of nucleic acid deaminases
2	PF01423 LSM	1.3e-13	61.7	LSM domain
3	PF14438 SM-ATX	14	17.3	Ataxin 2 SM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 34839.XP_005389445.1

Rank	PPI partner	STRING score	Description
1	34839.XP_005374546.1	0.999	Small nuclear ribonucleoprotein F
2	34839.XP_005375336.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
3	34839.XP_005386718.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
4	34839.XP_005387117.1	0.999	U6 snRNA-associated Sm-like protein LSm3
5	34839.XP_005388194.1	0.999	N-alpha-acetyltransferase 38, NatC auxiliary subunit
6	34839.XP_005405962.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
7	34839.XP_005393638.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
8	34839.XP_005396449.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
9	34839.XP_005398490.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns
10	34839.XP_005409627.1	0.998	U6 snRNA-associated Sm-like protein LSm4
11	34839.XP_005415044.1	0.998	U6 snRNA-associated Sm-like protein LSm5
12	34839.XP_005380809.1	0.997	Small nuclear ribonucleoprotein-associated proteins B and B' isoform X1
13	34839.XP_005385673.1	0.997	Small nuclear ribonucleoprotein G
14	34839.XP_005378743.1	0.996	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
15	34839.XP_005384495.1	0.996	U4/U6.U5 tri-snRNP-associated protein 1
16	34839.XP_005396520.1	0.996	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
17	34839.XP_005410107.1	0.996	pre-mRNA-processing factor 6
18	34839.XP_005414918.1	0.996	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 mRNAs, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns
19	34839.XP_005382059.1	0.995	Zinc finger matrin-type protein 2
20	34839.XP_005402669.1	0.994	pre-mRNA-processing-splicing factor 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.998	RNA binding
GO:0019899	0.994	enzyme binding
GO:0019900	0.727	kinase binding
GO:0019901	0.644	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008380	0.986	RNA splicing
GO:0006397	0.985	mRNA processing
GO:0000398	0.983	mRNA splicing, via spliceosome
GO:0050789	0.972	regulation of biological process
GO:0060255	0.959	regulation of macromolecule metabolic process
GO:0010468	0.931	regulation of gene expression
GO:0022613	0.897	ribonucleoprotein complex biogenesis
GO:0048519	0.890	negative regulation of biological process
GO:0071826	0.877	ribonucleoprotein complex subunit organization
GO:0022618	0.840	ribonucleoprotein complex assembly
GO:0044260	0.829	cellular macromolecule metabolic process
GO:0010629	0.825	negative regulation of gene expression
GO:0000387	0.748	spliceosomal snRNP assembly
GO:0006401	0.746	RNA catabolic process
GO:0050794	0.469	regulation of cellular process
GO:0006402	0.425	mRNA catabolic process
GO:0051171	0.314	regulation of nitrogen compound metabolic process
GO:0080090	0.312	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990904	1.000	ribonucleoprotein complex
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0120114	0.997	Sm-like protein family complex
GO:0005829	0.981	cytosol
GO:0005681	0.981	spliceosomal complex
GO:0071013	0.974	catalytic step 2 spliceosome
GO:0071005	0.974	U2-type precatalytic spliceosome
GO:0097525	0.971	spliceosomal snRNP complex
GO:0046540	0.868	U4/U6 x U5 tri-snRNP complex
GO:0120115	0.799	Lsm2-8 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]