StarFunc result for job id Q9Y337

User Input

>input (293 residues)
MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARS
DDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGH
YSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPS
AGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDS
CQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y337	1.000	1.000	1.580E-55	293	1.000	1.000	Q9Y337.pdb.gz	KLK5_HUMAN Kallikrein-5 OS=Homo sapiens OX=9606 GN=KLK5 PE=1 SV=3
2	AFDB:Q9D140	0.788	0.788	6.905E-44	293	0.696	0.696	Q9D140.pdb.gz	Q9D140_MOUSE Kallikrein c OS=Mus musculus OX=10090 GN=Klk5 PE=1 SV=1
3	AFDB:Q9Y5K2	0.745	0.857	1.942E-30	254	0.457	0.528	Q9Y5K2.pdb.gz	KLK4_HUMAN Kallikrein-4 OS=Homo sapiens OX=9606 GN=KLK4 PE=1 SV=2
4	AFDB:Q9P0G3	0.770	0.844	2.405E-30	267	0.410	0.449	Q9P0G3.pdb.gz	KLK14_HUMAN Kallikrein-14 OS=Homo sapiens OX=9606 GN=KLK14 PE=1 SV=2
5	AFDB:O60259	0.781	0.879	2.823E-30	260	0.396	0.446	O60259.pdb.gz	KLK8_HUMAN Kallikrein-8 OS=Homo sapiens OX=9606 GN=KLK8 PE=1 SV=1
6	AFDB:Q9UKR3	0.752	0.795	4.564E-30	277	0.427	0.451	Q9UKR3.pdb.gz	KLK13_HUMAN Kallikrein-13 OS=Homo sapiens OX=9606 GN=KLK13 PE=2 SV=1
7	AFDB:Q61955	0.755	0.850	5.961E-30	260	0.372	0.419	Q61955.pdb.gz	KLK8_MOUSE Kallikrein-8 OS=Mus musculus OX=10090 GN=Klk8 PE=1 SV=1
8	AFDB:Q6IE12	0.752	0.859	8.212E-30	256	0.444	0.508	Q6IE12.pdb.gz	Q6IE12_RAT Kallikrein 4 OS=Rattus norvegicus OX=10116 GN=Klk4 PE=2 SV=1
9	AFDB:P35030	0.766	0.738	1.131E-29	304	0.386	0.372	P35030.pdb.gz	TRY3_HUMAN Trypsin-3 OS=Homo sapiens OX=9606 GN=PRSS3 PE=1 SV=2
10	AFDB:Q9UBX7	0.753	0.781	3.471E-29	282	0.427	0.443	Q9UBX7.pdb.gz	KLK11_HUMAN Kallikrein-11 OS=Homo sapiens OX=9606 GN=KLK11 PE=1 SV=2
11	PDB:5ms3A	0.740	0.947	3.558E-29	228	0.379	0.487	5ms3A.pdb.gz	Specificity profiles and antagonistic Ca2+ and Zn2+ regulation of human KLK8/neuropsin activity by modules identified in crystal structures
12	PDB:1npmA	0.732	0.958	1.152E-28	223	0.369	0.484	1npmA.pdb.gz
13	PDB:6nvbB	0.736	0.958	1.504E-28	224	0.399	0.522	6nvbB.pdb.gz
14	PDB:2ra3A	0.745	0.970	3.176E-28	224	0.362	0.473	2ra3A.pdb.gz	Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.
15	PDB:2a31A	0.735	0.960	6.359E-28	223	0.352	0.462	2a31A.pdb.gz	NMR and crystallographic characterization of adventitious borate binding by trypsin.
16	PDB:6ahsA	0.720	0.937	1.199E-26	224	0.355	0.464	6ahsA.pdb.gz	Discovery and structure-activity relationship of imidazolinylindole derivatives as kallikrein 7 inhibitors.
17	PDB:6qfgA	0.730	0.953	2.531E-26	223	0.355	0.466	6qfgA.pdb.gz	Evaluation of a crystallographic surrogate for kallikrein 5 in the discovery of novel inhibitors for Netherton syndrome.
18	PDB:2qxgA	0.741	0.964	4.317E-26	224	0.372	0.487	2qxgA.pdb.gz	Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
19	PDB:4nffA	0.750	0.955	4.804E-26	229	0.341	0.437	4nffA.pdb.gz	Structure-function analyses of human kallikrein-related peptidase 2 establish the 99-loop as master regulator of activity
20	PDB:1tgsZ	0.731	0.946	8.194E-26	225	0.362	0.471	1tgsZ.pdb.gz	Three-dimensional structure of the complex between pancreatic secretory trypsin inhibitor (Kazal type) and trypsinogen at 1.8 A resolution. Structure solution, crystallographic refinement and preliminary structural interpretation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y337	0.0	609	293	1.000	1.000	KLK5_HUMAN Kallikrein-5 OS=Homo sapiens OX=9606 GN=KLK5 PE=1 SV=3
2	Q9D140	4.01e-157	441	293	0.700	0.700	Q9D140_MOUSE Kallikrein c OS=Mus musculus OX=10090 GN=Klk5 PE=1 SV=1
3	Q8CGR6	8.09e-82	249	276	0.454	0.482	Q8CGR6_MOUSE Glandular kallikrein KLK13 OS=Mus musculus OX=10090 GN=Klk13 PE=1 SV=1
4	Q9UBX7	7.99e-81	247	282	0.403	0.418	KLK11_HUMAN Kallikrein-11 OS=Homo sapiens OX=9606 GN=KLK11 PE=1 SV=2
5	Q9QYN3	2.00e-80	246	276	0.396	0.420	KLK11_MOUSE Kallikrein-11 OS=Mus musculus OX=10090 GN=Klk11 PE=2 SV=1
6	O60259	2.48e-77	238	260	0.399	0.450	KLK8_HUMAN Kallikrein-8 OS=Homo sapiens OX=9606 GN=KLK8 PE=1 SV=1
7	Q9Y5K2	6.27e-77	236	254	0.451	0.520	KLK4_HUMAN Kallikrein-4 OS=Homo sapiens OX=9606 GN=KLK4 PE=1 SV=2
8	Q9P0G3	1.77e-76	236	267	0.392	0.431	KLK14_HUMAN Kallikrein-14 OS=Homo sapiens OX=9606 GN=KLK14 PE=1 SV=2
9	Q9Z0M1	2.19e-76	235	255	0.447	0.514	KLK4_MOUSE Kallikrein-4 OS=Mus musculus OX=10090 GN=Klk4 PE=1 SV=1
10	Q61955	3.92e-76	234	260	0.386	0.435	KLK8_MOUSE Kallikrein-8 OS=Mus musculus OX=10090 GN=Klk8 PE=1 SV=1
11	Q9UKR3	4.91e-76	235	277	0.399	0.422	KLK13_HUMAN Kallikrein-13 OS=Homo sapiens OX=9606 GN=KLK13 PE=2 SV=1
12	P49862	1.15e-74	231	253	0.389	0.451	KLK7_HUMAN Kallikrein-7 OS=Homo sapiens OX=9606 GN=KLK7 PE=1 SV=1
13	Q6IE12	1.33e-72	225	256	0.389	0.445	Q6IE12_RAT Kallikrein 4 OS=Rattus norvegicus OX=10116 GN=Klk4 PE=2 SV=1
14	P00762	4.03e-72	224	246	0.392	0.467	TRY1_RAT Serine protease 1 OS=Rattus norvegicus OX=10116 GN=Prss1 PE=1 SV=1
15	Q91VE3	5.33e-72	224	249	0.355	0.418	KLK7_MOUSE Kallikrein-7 OS=Mus musculus OX=10090 GN=Klk7 PE=1 SV=1
16	Q9CPN9	7.99e-72	223	247	0.372	0.441	Q9CPN9_MOUSE RIKEN cDNA 2210010C04 gene OS=Mus musculus OX=10090 GN=Prss3b PE=1 SV=1
17	P00760	3.66e-71	221	246	0.382	0.455	TRY1_BOVIN Serine protease 1 OS=Bos taurus OX=9913 GN=PRSS1 PE=1 SV=3
18	Q9D7Y7	1.45e-70	220	247	0.369	0.437	Q9D7Y7_MOUSE Peptidase S1 domain-containing protein OS=Mus musculus OX=10090 GN=Prss3b PE=2 SV=1
19	P07477	3.77e-70	219	247	0.369	0.437	TRY1_HUMAN Serine protease 1 OS=Homo sapiens OX=9606 GN=PRSS1 PE=1 SV=1
20	P00763	4.44e-69	216	246	0.362	0.431	TRY2_RAT Anionic trypsin-2 OS=Rattus norvegicus OX=10116 GN=Prss2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09342 DUF1986	65	15.3	Domain of unknown function (DUF1986)
2	PF00089 Trypsin	4.9e-65	231.0	Trypsin
3	PF13365 Trypsin_2	0.045	26.2	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337733

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357789	0.989	Filaggrin
2	9606.ENSP00000375682	0.957	Kallikrein-8
3	9606.ENSP00000352936	0.951	Serine protease inhibitor Kazal-type 5
4	9606.ENSP00000367139	0.950	Serine protease inhibitor Kazal-type 9
5	9606.ENSP00000278742	0.917	Suppressor of tumorigenicity 14 protein
6	9606.ENSP00000324870	0.896	Serine protease inhibitor Kazal-type 6
7	9606.ENSP00000393417	0.724	Caspase-14
8	9606.ENSP00000375683	0.694	Kallikrein-7
9	9606.ENSP00000257192	0.693	Desmoglein-1
10	9606.ENSP00000365465	0.667	Corneodesmosin
11	9606.ENSP00000265023	0.617	Kininogen-1
12	9606.ENSP00000296435	0.606	Cathelicidin antimicrobial peptide
13	9606.ENSP00000257198	0.574	Desmocollin-1
14	9606.ENSP00000234590	0.551	Alpha-enolase
15	9606.ENSP00000357753	0.542	Involucrin
16	9606.ENSP00000391490	0.536	Anterior gradient protein 2 homolog
17	9606.ENSP00000357731	0.526	Loricrin
18	9606.ENSP00000227266	0.520	Dipeptidyl peptidase 1
19	9606.ENSP00000431984	0.513	Calpain-1 catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004175	1.000	endopeptidase activity
GO:0008236	1.000	serine-type peptidase activity
GO:0005515	0.989	protein binding
GO:0004252	0.986	serine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.961	biological regulation
GO:0008544	0.944	epidermis development
GO:0050789	0.938	regulation of biological process
GO:0043588	0.915	skin development
GO:0009987	0.899	cellular process
GO:0050794	0.854	regulation of cellular process
GO:0023051	0.819	regulation of signaling
GO:0010646	0.815	regulation of cell communication
GO:0048518	0.771	positive regulation of biological process
GO:0019222	0.740	regulation of metabolic process
GO:0050776	0.726	regulation of immune response
GO:0060255	0.721	regulation of macromolecule metabolic process
GO:0048522	0.714	positive regulation of cellular process
GO:0010628	0.693	positive regulation of gene expression
GO:0002702	0.682	positive regulation of production of molecular mediator of immune response
GO:1901564	0.677	organonitrogen compound metabolic process
GO:0002833	0.673	positive regulation of response to biotic stimulus
GO:0044238	0.663	primary metabolic process
GO:0002225	0.661	positive regulation of antimicrobial peptide production
GO:1900426	0.643	positive regulation of defense response to bacterium
GO:0002786	0.618	regulation of antibacterial peptide production
GO:0043170	0.573	macromolecule metabolic process
GO:0019538	0.555	protein metabolic process
GO:0009913	0.485	epidermal cell differentiation
GO:0009966	0.442	regulation of signal transduction
GO:0050896	0.415	response to stimulus
GO:0030216	0.411	keratinocyte differentiation
GO:0032501	0.349	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0043227	0.996	membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0031982	0.993	vesicle
GO:0005737	0.990	cytoplasm
GO:0043231	0.970	intracellular membrane-bounded organelle
GO:0005615	0.962	extracellular space
GO:0030141	0.914	secretory granule
GO:0005829	0.782	cytosol
GO:1903561	0.420	extracellular vesicle
GO:0071944	0.409	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.21.-	0.986	Serine endopeptidases.

[back to server]