StarFunc result for job id Q9Y371

User Input

>input (365 residues)
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRNSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQ
CYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIGSSAMASTSGLVITSPSNLSD
LKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITY
LELLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJU5	0.741	0.741	1.080E-52	365	1.000	1.000	A0A140VJU5.pdb.gz	A0A140VJU5_HUMAN Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1 PE=2 SV=1
2	AFDB:A0A087WW40	0.705	0.656	4.140E-50	394	0.975	0.904	A0A087WW40.pdb.gz	A0A087WW40_HUMAN Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1 PE=1 SV=1
3	AFDB:Q5PPJ9	0.706	0.639	7.862E-39	404	0.633	0.572	Q5PPJ9.pdb.gz	SHLB2_RAT Endophilin-B2 OS=Rattus norvegicus OX=10116 GN=Sh3glb2 PE=1 SV=2
4	AFDB:Q8SYD9	0.674	0.633	1.126E-32	390	0.436	0.408	Q8SYD9.pdb.gz	Q8SYD9_DROME Endophilin B, isoform A OS=Drosophila melanogaster OX=7227 GN=EndoB PE=1 SV=1
5	AFDB:A8DYJ1	0.709	0.686	7.422E-27	378	0.405	0.392	A8DYJ1.pdb.gz	A8DYJ1_DROME Endophilin B, isoform C OS=Drosophila melanogaster OX=7227 GN=EndoB PE=1 SV=1
6	PDB:6upnA	0.507	0.736	1.884E-24	245	0.668	0.996	6upnA.pdb.gz
7	AFDB:O35179	0.615	0.637	1.036E-21	352	0.252	0.261	O35179.pdb.gz	SH3G2_RAT Endophilin-A1 OS=Rattus norvegicus OX=10116 GN=Sh3gl2 PE=1 SV=2
8	AFDB:O35964	0.614	0.609	1.342E-21	368	0.252	0.250	O35964.pdb.gz	SH3G1_RAT Endophilin-A2 OS=Rattus norvegicus OX=10116 GN=Sh3gl1 PE=1 SV=1
9	AFDB:Q6TGT7	0.614	0.583	3.587E-21	386	0.230	0.218	Q6TGT7.pdb.gz	Q6TGT7_DANRE Endophilin-A3 OS=Danio rerio OX=7955 GN=SH3GL3 PE=2 SV=1
10	AFDB:B1V8A0	0.606	0.582	3.318E-20	381	0.233	0.223	B1V8A0.pdb.gz	SH3GH_CAEEL Endophilin-A homolog OS=Caenorhabditis elegans OX=6239 GN=unc-57 PE=1 SV=1
11	AFDB:Q99963	0.606	0.636	3.318E-20	347	0.241	0.254	Q99963.pdb.gz	SH3G3_HUMAN Endophilin-A3 OS=Homo sapiens OX=9606 GN=SH3GL3 PE=1 SV=1
12	PDB:6ikoA	0.207	0.244	6.458E-4	303	0.088	0.106	6ikoA.pdb.gz
13	PDB:3ehqA	0.152	0.295	1.726E-3	182	0.036	0.071	3ehqA.pdb.gz
14	PDB:2dybA	0.146	0.178	4.379E-3	298	0.044	0.054	2dybA.pdb.gz
15	PDB:2lqnA	0.148	0.176	5.386E-3	303	0.060	0.073	2lqnA.pdb.gz
16	PDB:3hajA	0.215	0.259	6.975E-3	286	0.068	0.087	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
17	PDB:3qwyA	0.147	0.311	7.346E-3	170	0.027	0.059	3qwyA.pdb.gz
18	PDB:1k9aB	0.151	0.126	7.736E-3	441	0.027	0.023	1k9aB.pdb.gz
19	PDB:1griA	0.150	0.255	9.514E-3	211	0.041	0.071	1griA.pdb.gz
20	PDB:1k0xA	0.157	0.489	1.298E-2	108	0.049	0.167	1k0xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WW40	0.0	741	394	1.000	0.926	A0A087WW40_HUMAN Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1 PE=1 SV=1
2	A0A140VJU5	0.0	757	365	1.000	1.000	A0A140VJU5_HUMAN Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1 PE=2 SV=1
3	Q6AYE2	0.0	718	365	0.948	0.948	SHLB1_RAT Endophilin-B1 OS=Rattus norvegicus OX=10116 GN=Sh3glb1 PE=2 SV=1
4	Q9JK48	0.0	722	365	0.959	0.959	SHLB1_MOUSE Endophilin-B1 OS=Mus musculus OX=10090 GN=Sh3glb1 PE=1 SV=1
5	Q9Y371	0.0	757	365	1.000	1.000	SHLB1_HUMAN Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1 PE=1 SV=1
6	Q9NR46	1.61e-165	469	395	0.630	0.582	SHLB2_HUMAN Endophilin-B2 OS=Homo sapiens OX=9606 GN=SH3GLB2 PE=1 SV=1
7	B7ZC38	5.32e-164	466	400	0.633	0.578	B7ZC38_HUMAN SH3 domain containing GRB2 like, endophilin B2 OS=Homo sapiens OX=9606 GN=SH3GLB2 PE=1 SV=1
8	Q5PPJ9	1.60e-156	447	404	0.649	0.587	SHLB2_RAT Endophilin-B2 OS=Rattus norvegicus OX=10116 GN=Sh3glb2 PE=1 SV=2
9	Q8T389	1.01e-103	312	378	0.449	0.434	Q8T389_DROME Endophilin B OS=Drosophila melanogaster OX=7227 GN=EndoB PE=1 SV=1
10	Q8IGU0	5.60e-103	310	378	0.447	0.431	Q8IGU0_DROME RE31027p OS=Drosophila melanogaster OX=7227 GN=EndoB PE=2 SV=1
11	Q8SYD9	3.38e-100	303	390	0.449	0.421	Q8SYD9_DROME Endophilin B, isoform A OS=Drosophila melanogaster OX=7227 GN=EndoB PE=1 SV=1
12	A8DYJ0	4.40e-93	284	366	0.416	0.415	A8DYJ0_DROME Endophilin B, isoform D OS=Drosophila melanogaster OX=7227 GN=EndoB PE=1 SV=1
13	A8DYJ1	2.10e-89	275	378	0.416	0.402	A8DYJ1_DROME Endophilin B, isoform C OS=Drosophila melanogaster OX=7227 GN=EndoB PE=1 SV=1
14	Q6FGM0	6.51e-32	125	368	0.268	0.266	Q6FGM0_HUMAN SH3-domain GRB2-like 1 OS=Homo sapiens OX=9606 GN=SH3GL1 PE=1 SV=1
15	Q99961	6.51e-32	125	368	0.268	0.266	SH3G1_HUMAN Endophilin-A2 OS=Homo sapiens OX=9606 GN=SH3GL1 PE=1 SV=1
16	Q62419	2.52e-29	118	368	0.255	0.253	SH3G1_MOUSE Endophilin-A2 OS=Mus musculus OX=10090 GN=Sh3gl1 PE=1 SV=1
17	O35964	3.70e-29	117	368	0.263	0.261	SH3G1_RAT Endophilin-A2 OS=Rattus norvegicus OX=10116 GN=Sh3gl1 PE=1 SV=1
18	Q62420	5.11e-27	111	352	0.266	0.276	SH3G2_MOUSE Endophilin-A1 OS=Mus musculus OX=10090 GN=Sh3gl2 PE=1 SV=2
19	O35179	6.50e-27	111	352	0.252	0.261	SH3G2_RAT Endophilin-A1 OS=Rattus norvegicus OX=10116 GN=Sh3gl2 PE=1 SV=2
20	Q99963	9.93e-27	110	347	0.258	0.271	SH3G3_HUMAN Endophilin-A3 OS=Homo sapiens OX=9606 GN=SH3GL3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03114 BAR	3.7e-71	251.1	BAR domain
2	PF10455 BAR_2	6.9e-07	40.3	Bin/amphiphysin/Rvs domain for vesicular trafficking
3	PF16746 BAR_3	0.00031	32.0	BAR domain of APPL family
4	PF00018 SH3_1	0.00019	32.3	SH3 domain
5	PF07653 SH3_2	0.0015	29.6	Variant SH3 domain
6	PF14604 SH3_9	7.5e-09	46.7	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000001374

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000004223	0.963	UV radiation resistance associated
2	9601.ENSPPYP00000022048	0.911	SH3-domain GRB2-like endophilin B2
3	9601.ENSPPYP00000022571	0.897	SH3-domain kinase binding protein 1
4	9601.ENSPPYP00000020385	0.870	Autophagy-related protein 9
5	9601.ENSPPYP00000014748	0.857	Involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS), the nucleating site for formation of the sequestering vesicle. Cycles between a juxta-nuclear trans-Golgi network compartment and late endosomes. Nutrient starvation induces accumulation on autophagosomes. Starvation-dependent trafficking requires ULK1, ATG13 and SUPT20H (By similarity)
6	9601.ENSPPYP00000012737	0.807	Pongo abelii Down syndrome critical region gene 3 (DSCR3), mRNA
7	9601.ENSPPYP00000004540	0.806	Cbl proto-oncogene, E3 ubiquitin protein ligase
8	9601.ENSPPYP00000015183	0.806	Cbl proto-oncogene B, E3 ubiquitin protein ligase
9	9601.ENSPPYP00000009414	0.805	Plays a central role in autophagy. Acts as core subunit of the PI3K complex that mediates formation of phosphatidylinositol 3- phosphate
10	9601.ENSPPYP00000022770	0.786	Coiled-coil domain containing 22
11	9601.ENSPPYP00000016550	0.679	Ankyrin repeat domain 17
12	9601.ENSPPYP00000023091	0.678	acyl-CoA synthetase long-chain family member 4
13	9601.ENSPPYP00000014341	0.654	Uncharacterized protein
14	9601.ENSPPYP00000008083	0.647	Acts as component of the retriever complex. The retriever complex is a heterotrimeric complex related to retromer cargo-selective complex (CSC) and essential for retromer-independent retrieval and recycling of numerous cargos such as integrin alpha-5/beta-1 (ITGA5:ITGB1). The recruitment of the retriever complex to the endosomal membrane involves CCC and WASH complexes. In the endosomes, drives the retrieval and recycling of NxxY-motif-containing cargo proteins by coupling to SNX17, a cargo essential for the homeostatic maintenance of numerous cell surface proteins associated with proc [...]
15	9601.ENSPPYP00000014278	0.647	Coiled-coil domain containing 93
16	9601.ENSPPYP00000001379	0.646	Outer dense fiber of sperm tails 2-like
17	9601.ENSPPYP00000000808	0.645	Neurotrophic tyrosine kinase, receptor, type 1
18	9601.ENSPPYP00000021301	0.633	COMM domain containing 5
19	9601.ENSPPYP00000019671	0.616	Receptor protein-tyrosine kinase
20	9601.ENSPPYP00000006635	0.615	Autophagy related 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.659	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0050789	0.974	regulation of biological process
GO:0008219	0.966	cell death
GO:0008152	0.946	metabolic process
GO:0044237	0.937	cellular metabolic process
GO:0048102	0.930	autophagic cell death
GO:0032386	0.905	regulation of intracellular transport
GO:0048519	0.879	negative regulation of biological process
GO:0009056	0.875	catabolic process
GO:0044248	0.872	cellular catabolic process
GO:0051130	0.818	positive regulation of cellular component organization
GO:0010506	0.780	regulation of autophagy
GO:1902115	0.769	regulation of organelle assembly
GO:0051179	0.753	localization
GO:0010508	0.751	positive regulation of autophagy
GO:0016239	0.734	positive regulation of macroautophagy
GO:0044088	0.733	regulation of vacuole organization
GO:1902117	0.719	positive regulation of organelle assembly
GO:2000785	0.709	regulation of autophagosome assembly
GO:0033157	0.705	regulation of intracellular protein transport
GO:1903747	0.682	regulation of establishment of protein localization to mitochondrion
GO:0071840	0.679	cellular component organization or biogenesis
GO:0016043	0.666	cellular component organization
GO:0032388	0.664	positive regulation of intracellular transport
GO:0051641	0.657	cellular localization
GO:1903829	0.613	positive regulation of protein localization
GO:0061919	0.577	process utilizing autophagic mechanism
GO:0006914	0.574	autophagy
GO:0051222	0.563	positive regulation of protein transport
GO:0008104	0.543	protein localization
GO:0048583	0.536	regulation of response to stimulus
GO:0061024	0.535	membrane organization
GO:0006950	0.524	response to stress
GO:0033365	0.522	protein localization to organelle
GO:0065008	0.507	regulation of biological quality
GO:0090316	0.488	positive regulation of intracellular protein transport
GO:0050793	0.479	regulation of developmental process
GO:0042149	0.409	cellular response to glucose starvation
GO:0010646	0.371	regulation of cell communication
GO:0023051	0.341	regulation of signaling
GO:0071704	0.318	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.995	membrane
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0012505	0.971	endomembrane system
GO:0005829	0.970	cytosol
GO:0032991	0.671	protein-containing complex
GO:0031982	0.545	vesicle
GO:0097708	0.505	intracellular vesicle
GO:0031410	0.504	cytoplasmic vesicle
GO:0031090	0.316	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]