StarFunc result for job id Q9Y385

User Input

>input (318 residues)
METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHG
RIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMP
TKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELA
RQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQP
TQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTDHGGSAVLIVILTLALAA
LIFRRIYLANEYIFDFEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JJZ4	0.824	0.824	3.132E-55	318	0.925	0.925	Q9JJZ4.pdb.gz	UB2J1_MOUSE Ubiquitin-conjugating enzyme E2 J1 OS=Mus musculus OX=10090 GN=Ube2j1 PE=1 SV=2
2	AFDB:Q9LSP7	0.450	0.463	6.381E-23	309	0.336	0.346	Q9LSP7.pdb.gz	UBC32_ARATH Ubiquitin-conjugating enzyme E2 32 OS=Arabidopsis thaliana OX=3702 GN=UBC32 PE=2 SV=1
3	AFDB:Q6P073	0.422	0.515	7.246E-19	259	0.252	0.309	Q6P073.pdb.gz	UB2J2_MOUSE Ubiquitin-conjugating enzyme E2 J2 OS=Mus musculus OX=10090 GN=Ube2j2 PE=1 SV=1
4	AFDB:Q9FK29	0.423	0.549	5.108E-18	243	0.233	0.305	Q9FK29.pdb.gz	UBC33_ARATH Probable ubiquitin-conjugating enzyme E2 33 OS=Arabidopsis thaliana OX=3702 GN=UBC33 PE=2 SV=1
5	AFDB:Q9SHI7	0.430	0.571	1.200E-17	237	0.245	0.329	Q9SHI7.pdb.gz	UBC34_ARATH Ubiquitin-conjugating enzyme E2 34 OS=Arabidopsis thaliana OX=3702 GN=UBC34 PE=2 SV=1
6	AFDB:P33296	0.416	0.523	4.596E-17	250	0.239	0.304	P33296.pdb.gz	UBC6_YEAST Ubiquitin-conjugating enzyme E2 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC6 PE=1 SV=1
7	AFDB:Q583Z6	0.443	0.633	3.444E-16	220	0.201	0.291	Q583Z6.pdb.gz	Q583Z6_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.480 PE=4 SV=1
8	AFDB:Q9N490	0.436	0.627	4.673E-16	218	0.217	0.317	Q9N490.pdb.gz	Q9N490_CAEEL UBC core domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ubc-15 PE=1 SV=2
9	PDB:3bzhA	0.318	0.604	7.512E-10	161	0.151	0.298	3bzhA.pdb.gz
10	AFDB:P52478	0.328	0.529	7.910E-10	192	0.129	0.214	P52478.pdb.gz	UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans OX=6239 GN=ubc-1 PE=1 SV=1
11	AFDB:Q8I607	0.330	0.680	1.213E-9	147	0.160	0.347	Q8I607.pdb.gz	Q8I607_PLAF7 Ubiquitin-conjugating enzyme E2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1203900 PE=3 SV=1
12	PDB:6cyrA	0.343	0.686	1.301E-9	153	0.107	0.222	6cyrA.pdb.gz
13	PDB:3e46A	0.330	0.506	3.672E-9	202	0.113	0.178	3e46A.pdb.gz
14	PDB:2cyxA	0.319	0.582	3.903E-9	169	0.135	0.254	2cyxA.pdb.gz
15	PDB:4ii2C	0.309	0.634	4.409E-9	149	0.151	0.322	4ii2C.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
16	PDB:2aakA	0.324	0.656	5.295E-9	150	0.113	0.240	2aakA.pdb.gz
17	PDB:3ptfA	0.329	0.654	5.629E-9	153	0.148	0.307	3ptfA.pdb.gz
18	PDB:5aieB	0.329	0.662	5.983E-9	150	0.132	0.280	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.
19	PDB:7jzvA	0.324	0.401	5.983E-9	253	0.138	0.174	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
20	PDB:4m1nC	0.343	0.644	6.760E-9	160	0.126	0.250	4m1nC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JJZ4	0.0	584	318	0.925	0.925	UB2J1_MOUSE Ubiquitin-conjugating enzyme E2 J1 OS=Mus musculus OX=10090 GN=Ube2j1 PE=1 SV=2
2	Q9Y385	0.0	663	318	1.000	1.000	UB2J1_HUMAN Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2
3	Q9LSP7	1.21e-63	205	309	0.277	0.285	UBC32_ARATH Ubiquitin-conjugating enzyme E2 32 OS=Arabidopsis thaliana OX=3702 GN=UBC32 PE=2 SV=1
4	Q8N2K1	4.72e-37	135	259	0.186	0.228	UB2J2_HUMAN Ubiquitin-conjugating enzyme E2 J2 OS=Homo sapiens OX=9606 GN=UBE2J2 PE=1 SV=3
5	Q9N490	5.13e-37	134	218	0.189	0.275	Q9N490_CAEEL UBC core domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ubc-15 PE=1 SV=2
6	Q6P073	9.59e-37	134	259	0.192	0.236	UB2J2_MOUSE Ubiquitin-conjugating enzyme E2 J2 OS=Mus musculus OX=10090 GN=Ube2j2 PE=1 SV=1
7	Q9FK29	9.99e-36	131	243	0.192	0.251	UBC33_ARATH Probable ubiquitin-conjugating enzyme E2 33 OS=Arabidopsis thaliana OX=3702 GN=UBC33 PE=2 SV=1
8	Q9SHI7	1.15e-35	130	237	0.195	0.262	UBC34_ARATH Ubiquitin-conjugating enzyme E2 34 OS=Arabidopsis thaliana OX=3702 GN=UBC34 PE=2 SV=1
9	Q583Z6	4.85e-35	128	220	0.186	0.268	Q583Z6_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.480 PE=4 SV=1
10	P33296	7.03e-35	129	250	0.179	0.228	UBC6_YEAST Ubiquitin-conjugating enzyme E2 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC6 PE=1 SV=1
11	Q8I607	5.69e-17	78.6	147	0.138	0.299	Q8I607_PLAF7 Ubiquitin-conjugating enzyme E2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1203900 PE=3 SV=1
12	D3ZDK2	3.83e-16	76.3	147	0.129	0.279	UB2D1_RAT Ubiquitin-conjugating enzyme E2 D1 OS=Rattus norvegicus OX=10116 GN=Ube2d1 PE=1 SV=1
13	P51668	3.83e-16	76.3	147	0.129	0.279	UB2D1_HUMAN Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens OX=9606 GN=UBE2D1 PE=1 SV=1
14	P61080	3.83e-16	76.3	147	0.129	0.279	UB2D1_MOUSE Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus OX=10090 GN=Ube2d1 PE=1 SV=1
15	P52482	4.35e-16	77.4	193	0.135	0.223	UB2E1_MOUSE Ubiquitin-conjugating enzyme E2 E1 OS=Mus musculus OX=10090 GN=Ube2e1 PE=1 SV=1
16	P51965	4.39e-16	77.4	193	0.135	0.223	UB2E1_HUMAN Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens OX=9606 GN=UBE2E1 PE=1 SV=1
17	P35134	7.27e-16	75.5	148	0.129	0.277	UBC11_ARATH Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana OX=3702 GN=UBC11 PE=1 SV=2
18	Q96LR5	1.21e-15	76.3	201	0.129	0.204	UB2E2_HUMAN Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens OX=9606 GN=UBE2E2 PE=1 SV=1
19	Q8S919	2.37e-15	74.3	148	0.132	0.284	UBC5B_ORYSJ Ubiquitin-conjugating enzyme E2 5B OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5B PE=2 SV=1
20	P52485	3.81e-15	75.5	232	0.132	0.181	UBCD2_DROME Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12156 ATPase-cat_bd	2.9e+02	13.6	Putative metal-binding domain of cation transport ATPase
2	PF05773 RWD	2.3e+02	13.5	RWD domain
3	PF00179 UQ_con	1.7e-14	65.1	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000451261

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337053	0.979	Protein sel-1 homolog 1
2	9606.ENSP00000338413	0.979	Ubiquitin-like modifier-activating enzyme 1
3	9606.ENSP00000347836	0.969	Ubiquitin-conjugating enzyme E2 H
4	9606.ENSP00000397453	0.969	Ubiquitin-conjugating enzyme E2 W
5	9606.ENSP00000428209	0.959	Ubiquitin-conjugating enzyme E2 variant 2
6	9606.ENSP00000292211	0.954	Ubiquitin-conjugating enzyme E2 Q1
7	9606.ENSP00000340305	0.954	Ubiquitin-conjugating enzyme E2 variant 1
8	9606.ENSP00000313454	0.953	Ubiquitin-like modifier-activating enzyme 6
9	9606.ENSP00000264552	0.952	Ubiquitin-conjugating enzyme E2 S
10	9606.ENSP00000366395	0.950	E3 ubiquitin-protein ligase synoviolin
11	9606.ENSP00000333266	0.949	Ubiquitin-like modifier-activating enzyme 7
12	9606.ENSP00000360116	0.948	Ubiquitin-conjugating enzyme E2 U
13	9606.ENSP00000478474	0.947	NEDD8-conjugating enzyme UBE2F
14	9606.ENSP00000323687	0.946	(E3-independent) E2 ubiquitin-conjugating enzyme
15	9606.ENSP00000253023	0.943	NEDD8-conjugating enzyme Ubc12
16	9606.ENSP00000287156	0.943	Ubiquitin/ISG15-conjugating enzyme E2 L6
17	9606.ENSP00000267938	0.937	Ubiquitin-conjugating enzyme E2 Q2
18	9606.ENSP00000354340	0.932	NEDD8-activating enzyme E1 catalytic subunit
19	9606.ENSP00000364235	0.932	E3 ubiquitin-protein ligase RNF5
20	9606.ENSP00000348565	0.930	Ubiquitin-like modifier-activating enzyme 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061631	1.000	ubiquitin conjugating enzyme activity
GO:0031625	0.999	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0050896	0.995	response to stimulus
GO:0033554	0.992	cellular response to stress
GO:0050789	0.991	regulation of biological process
GO:0042221	0.990	response to chemical
GO:0043161	0.986	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0010243	0.984	response to organonitrogen compound
GO:0036503	0.974	ERAD pathway
GO:0030433	0.947	ubiquitin-dependent ERAD pathway
GO:0050794	0.910	regulation of cellular process
GO:0043412	0.854	macromolecule modification
GO:0036211	0.799	protein modification process
GO:0070647	0.333	protein modification by small protein conjugation or removal

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0005634	0.600	nucleus
GO:0032991	0.500	protein-containing complex
GO:0016020	0.460	membrane
GO:0005829	0.305	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.2.23	1.000	E2 ubiquitin-conjugating enzyme.

[back to server]