StarFunc result for job id Q9Y3B8

User Input

>input (237 residues)
MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQI
IEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQA
EYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWY
PEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D8S4	0.876	0.876	8.667E-43	237	0.928	0.928	Q9D8S4.pdb.gz	ORN_MOUSE Oligoribonuclease, mitochondrial OS=Mus musculus OX=10090 GN=Rexo2 PE=1 SV=2
2	PDB:6styA	0.785	0.937	7.291E-33	198	0.806	0.965	6styA.pdb.gz	Human REXO2 controls short mitochondrial RNAs generated by mtRNA processing and decay machinery to prevent accumulation of double-stranded RNA.
3	AFDB:Q556Y2	0.740	0.921	1.154E-27	190	0.468	0.584	Q556Y2.pdb.gz	ORN_DICDI Probable oligoribonuclease OS=Dictyostelium discoideum OX=44689 GN=rexo2-1 PE=3 SV=1
4	AFDB:P0A784	0.734	0.956	4.451E-24	181	0.367	0.481	P0A784.pdb.gz	ORN_ECOLI Oligoribonuclease OS=Escherichia coli (strain K12) OX=83333 GN=orn PE=1 SV=2
5	PDB:2igiA	0.729	0.954	7.590E-24	180	0.367	0.483	2igiA.pdb.gz	Crystal Structure of Oligoribonuclease, the lone essential exoribonuclease in Escherichia coli
6	AFDB:O94626	0.685	0.645	2.181E-20	252	0.371	0.349	O94626.pdb.gz	ORN_SCHPO Probable oligoribonuclease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rex2 PE=3 SV=2
7	AFDB:P54964	0.732	0.646	2.181E-20	269	0.329	0.290	P54964.pdb.gz	ORN_YEAST Oligoribonuclease, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REX2 PE=1 SV=1
8	AFDB:Q682U6	0.524	0.407	3.369E-6	316	0.173	0.130	Q682U6.pdb.gz	DPD1_ARATH Exonuclease DPD1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DPD1 PE=1 SV=1
9	AFDB:O74856	0.563	0.414	9.317E-6	335	0.165	0.116	O74856.pdb.gz	CAF1_SCHPO Poly(A) ribonuclease pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=caf1 PE=1 SV=2
10	AFDB:P04995	0.575	0.302	1.334E-5	475	0.122	0.061	P04995.pdb.gz	EX1_ECOLI Exodeoxyribonuclease I OS=Escherichia coli (strain K12) OX=83333 GN=sbcB PE=1 SV=2
11	PDB:2p51A	0.563	0.528	1.791E-5	255	0.148	0.137	2p51A.pdb.gz	The 1.4-A crystal structure of the S. pombe Pop2p deadenylase subunit unveils the configuration of an active enzyme
12	AFDB:Q8WTP8	0.415	0.322	1.799E-5	325	0.173	0.126	Q8WTP8.pdb.gz	AEN_HUMAN Apoptosis-enhancing nuclease OS=Homo sapiens OX=9606 GN=AEN PE=1 SV=2
13	AFDB:Q54EC1	0.424	0.172	1.910E-5	694	0.127	0.043	Q54EC1.pdb.gz	Q54EC1_DICDI RNA exonuclease 1 OS=Dictyostelium discoideum OX=44689 GN=rexo1 PE=4 SV=1
14	PDB:4js4A	0.522	0.281	2.415E-5	468	0.143	0.073	4js4A.pdb.gz	Crystal structures of Escherichia coli exonuclease I in complex with single-stranded DNA provide insights into the mechanism of processive digestion.
15	PDB:3v9xB	0.536	0.592	3.258E-5	212	0.110	0.123	3v9xB.pdb.gz	How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
16	PDB:3c95A	0.502	0.284	6.292E-5	446	0.118	0.063	3c95A.pdb.gz
17	PDB:3cg7A	0.540	0.443	9.565E-5	296	0.118	0.095	3cg7A.pdb.gz	Crystal structure of CRN-4: implications for domain function in apoptotic DNA degradation
18	PDB:3u3yB	0.472	0.504	1.015E-4	220	0.143	0.155	3u3yB.pdb.gz	Defects in DNA degradation revealed in crystal structures of TREX1 exonuclease mutations linked to autoimmune disease.
19	PDB:5z9xA	0.432	0.366	1.078E-4	288	0.127	0.104	5z9xA.pdb.gz	Structural and biochemical insights into small RNA 3' end trimming by Arabidopsis SDN1.
20	PDB:1y97A	0.443	0.483	1.215E-4	214	0.127	0.140	1y97A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y3B8	8.18e-180	494	237	1.000	1.000	ORN_HUMAN Oligoribonuclease, mitochondrial OS=Homo sapiens OX=9606 GN=REXO2 PE=1 SV=3
2	F5GYG5	1.07e-164	455	222	0.937	1.000	F5GYG5_HUMAN RNA exonuclease 2 OS=Homo sapiens OX=9606 GN=REXO2 PE=1 SV=1
3	Q9D8S4	5.53e-161	446	237	0.941	0.941	ORN_MOUSE Oligoribonuclease, mitochondrial OS=Mus musculus OX=10090 GN=Rexo2 PE=1 SV=2
4	H0YG54	6.09e-141	394	188	0.793	1.000	H0YG54_HUMAN RNA exonuclease 2 OS=Homo sapiens OX=9606 GN=REXO2 PE=1 SV=2
5	H0YGR4	2.40e-138	387	192	0.806	0.995	H0YGR4_HUMAN RNA exonuclease 2 (Fragment) OS=Homo sapiens OX=9606 GN=REXO2 PE=1 SV=1
6	Q556Y2	8.22e-81	242	190	0.473	0.589	ORN_DICDI Probable oligoribonuclease OS=Dictyostelium discoideum OX=44689 GN=rexo2-1 PE=3 SV=1
7	P0A784	8.99e-59	186	181	0.380	0.497	ORN_ECOLI Oligoribonuclease OS=Escherichia coli (strain K12) OX=83333 GN=orn PE=1 SV=2
8	O94626	1.92e-48	161	252	0.342	0.321	ORN_SCHPO Probable oligoribonuclease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rex2 PE=3 SV=2
9	P54964	1.34e-42	147	269	0.338	0.297	ORN_YEAST Oligoribonuclease, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REX2 PE=1 SV=1
10	Q8IX06	0.60	33.5	675	0.165	0.058	GOR_HUMAN Putative exonuclease GOR OS=Homo sapiens OX=9606 GN=REXO1L1P PE=5 SV=2
11	Q17R54	2.0	32.0	579	0.114	0.047	Q17R54_HUMAN Synapsin III OS=Homo sapiens OX=9606 GN=SYN3 PE=1 SV=1
12	Q8RWY6	2.3	32.0	1439	0.127	0.021	CLASP_ARATH CLIP-associated protein OS=Arabidopsis thaliana OX=3702 GN=CLASP PE=1 SV=1
13	P49966	2.8	31.6	497	0.059	0.028	SR542_ARATH Signal recognition particle subunit SRP54 2 OS=Arabidopsis thaliana OX=3702 GN=SRP-54B PE=3 SV=2
14	P51648	3.8	31.2	485	0.148	0.072	AL3A2_HUMAN Aldehyde dehydrogenase family 3 member A2 OS=Homo sapiens OX=9606 GN=ALDH3A2 PE=1 SV=1
15	O35381	4.5	30.4	247	0.156	0.150	AN32A_MOUSE Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Mus musculus OX=10090 GN=Anp32a PE=1 SV=1
16	Q9FG30	4.8	30.4	240	0.114	0.113	C3H52_ARATH Zinc finger CCCH domain-containing protein 52 OS=Arabidopsis thaliana OX=3702 GN=At5g06770 PE=1 SV=1
17	P51534	5.8	30.8	789	0.072	0.022	SHE4_YEAST SWI5-dependent HO expression protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SHE4 PE=1 SV=2
18	Q4GZB5	6.6	30.4	457	0.093	0.048	Q4GZB5_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1030 PE=4 SV=1
19	O77316	6.7	30.4	419	0.072	0.041	O77316_PLAF7 RNA-binding protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0302800 PE=4 SV=1
20	Q9NX36	6.7	30.4	388	0.093	0.057	DJC28_HUMAN DnaJ homolog subfamily C member 28 OS=Homo sapiens OX=9606 GN=DNAJC28 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00929 RNase_T	2.6e-30	117.6	Exonuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265881

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000170168	0.916	RNA exonuclease 1 homolog
2	9606.ENSP00000261377	0.916	Putative RNA exonuclease NEF-sp
3	9606.ENSP00000361010	0.837	REX4 homolog, 3'-5' exonuclease
4	9606.ENSP00000274606	0.810	H/ACA ribonucleoprotein complex subunit 2
5	9606.ENSP00000355506	0.769	Exonuclease 1
6	9606.ENSP00000419665	0.740	Single-stranded DNA-binding protein, mitochondrial
7	9606.ENSP00000301175	0.724	Hydroxyproline dehydrogenase
8	9606.ENSP00000466989	0.716	Leucine-rich repeat and fibronectin type-III domain-containing protein 3
9	9606.ENSP00000254878	0.713	2-iminobutanoate/2-iminopropanoate deaminase
10	9606.ENSP00000324124	0.713	DNA-directed RNA polymerases I, II, and III subunit RPABC5
11	9606.ENSP00000353732	0.708	CAP-Gly domain-containing linker protein 3
12	9606.ENSP00000221859	0.701	DNA-directed RNA polymerase II subunit RPB9
13	9606.ENSP00000382071	0.688	Biotin--protein ligase
14	9606.ENSP00000354040	0.672	Nucleolar GTP-binding protein 1
15	9606.ENSP00000380109	0.670	NF-kappa-B inhibitor delta
16	9606.ENSP00000318585	0.641	Beta-secretase 1
17	9606.ENSP00000366135	0.627	Exosome component 10
18	9606.ENSP00000400646	0.623	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
19	9606.ENSP00000301159	0.605	Protein lin-37 homolog
20	9606.ENSP00000355587	0.601	Cancer-related nucleoside-triphosphatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008296	1.000	3'-5'-DNA exonuclease activity
GO:0000175	1.000	3'-5'-RNA exonuclease activity
GO:0000287	0.998	magnesium ion binding
GO:0005515	0.875	protein binding
GO:1901363	0.852	heterocyclic compound binding
GO:0097159	0.851	organic cyclic compound binding
GO:0003676	0.699	nucleic acid binding
GO:0008310	0.365	single-stranded DNA 3'-5' DNA exonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:1901360	0.989	organic cyclic compound metabolic process
GO:0034641	0.986	cellular nitrogen compound metabolic process
GO:0046483	0.985	heterocycle metabolic process
GO:0006725	0.983	cellular aromatic compound metabolic process
GO:0006139	0.954	nucleobase-containing compound metabolic process
GO:0055086	0.826	nucleobase-containing small molecule metabolic process
GO:0019637	0.787	organophosphate metabolic process
GO:0006796	0.758	phosphate-containing compound metabolic process
GO:0043170	0.746	macromolecule metabolic process
GO:0009117	0.679	nucleotide metabolic process
GO:0090304	0.472	nucleic acid metabolic process
GO:0016070	0.328	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0031981	0.999	nuclear lumen
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005730	0.764	nucleolus
GO:0005654	0.611	nucleoplasm
GO:0030054	0.607	cell junction
GO:0070161	0.588	anchoring junction
GO:0016020	0.486	membrane
GO:0030055	0.397	cell-substrate junction
GO:0005925	0.358	focal adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.11.-	1.000	Exodeoxyribonucleases producing 5'-phosphomonoesters.
EC:3.1.13.-	1.000	Exoribonucleases producing 5'-phosphomonoesters.
EC:3.1.11.1	0.365	exodeoxyribonuclease I.

[back to server]