StarFunc result for job id Q9Y3C1

User Input

>input (178 residues)
MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAV
DPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR
YMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y3C1	1.000	1.000	3.401E-27	178	1.000	1.000	Q9Y3C1.pdb.gz	NOP16_HUMAN Nucleolar protein 16 OS=Homo sapiens OX=9606 GN=NOP16 PE=1 SV=2
2	AFDB:D6RIC3	0.572	0.672	1.379E-16	150	0.736	0.873	D6RIC3.pdb.gz	D6RIC3_HUMAN Nucleolar protein 16 OS=Homo sapiens OX=9606 GN=NOP16 PE=1 SV=1
3	AFDB:A0A0C4DGU5	0.550	0.428	1.810E-16	231	0.736	0.567	A0A0C4DGU5.pdb.gz	A0A0C4DGU5_HUMAN Nucleolar protein 16 OS=Homo sapiens OX=9606 GN=NOP16 PE=1 SV=1
4	AFDB:Q94402	0.563	0.535	2.469E-9	189	0.320	0.302	Q94402.pdb.gz	NOP16_CAEEL Nucleolar protein 16 OS=Caenorhabditis elegans OX=6239 GN=nol-16 PE=3 SV=1
5	PDB:6elzv	0.392	0.502	1.604E-4	130	0.180	0.246	6elzv.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
6	AFDB:P40007	0.417	0.336	2.385E-4	231	0.219	0.169	P40007.pdb.gz	NOP16_YEAST Nucleolar protein 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOP16 PE=1 SV=1
7	PDB:6c0f7	0.382	0.426	5.309E-4	156	0.213	0.244	6c0f7.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
8	AFDB:Q57W06	0.308	0.289	1.220E-3	191	0.219	0.204	Q57W06.pdb.gz	Q57W06_TRYB2 Nucleolar protein 16 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.500 PE=3 SV=1
9	AFDB:Q9Y7Z1	0.436	0.383	1.785E-3	209	0.208	0.177	Q9Y7Z1.pdb.gz	NOP16_SCHPO Nucleolar protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nop16 PE=1 SV=1
10	PDB:4czzB	0.262	0.336	1.440E-1	133	0.084	0.113	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
11	AFDB:F4J6V1	0.269	0.038	2.968E-1	1656	0.157	0.017	F4J6V1.pdb.gz	F4J6V1_ARATH Duplicated homeodomain-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=PWR PE=1 SV=1
12	AFDB:B7ZLQ5	0.283	0.059	3.309E-1	1070	0.135	0.022	B7ZLQ5.pdb.gz	B7ZLQ5_HUMAN SMARCA1 protein OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1
13	AFDB:Q24368	0.279	0.060	5.701E-1	1027	0.146	0.025	Q24368.pdb.gz	ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster OX=7227 GN=Iswi PE=1 SV=1
14	PDB:5l3cB	0.247	0.314	1.578	134	0.079	0.104	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
15	PDB:2bidA	0.161	0.151	1.961	197	0.140	0.127	2bidA.pdb.gz
16	PDB:2q0oA	0.248	0.197	3.030	235	0.056	0.043	2q0oA.pdb.gz	Structural basis for antiactivation in bacterial quorum sensing.
17	PDB:6v7wE	0.217	0.171	3.030	234	0.051	0.038	6v7wE.pdb.gz	A phage-encoded anti-activator inhibits quorum sensing in Pseudomonas aeruginosa.
18	PDB:6elzJ	0.163	0.179	3.767	145	0.135	0.166	6elzJ.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
19	PDB:5gjqV	0.123	0.095	3.978	257	0.090	0.062	5gjqV.pdb.gz	An atomic structure of the human 26S proteasome.
20	PDB:7c4jB	0.200	0.100	4.944	395	0.152	0.068	7c4jB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y3C1	5.99e-131	365	178	1.000	1.000	NOP16_HUMAN Nucleolar protein 16 OS=Homo sapiens OX=9606 GN=NOP16 PE=1 SV=2
2	D6RIC3	1.57e-92	267	150	0.742	0.880	D6RIC3_HUMAN Nucleolar protein 16 OS=Homo sapiens OX=9606 GN=NOP16 PE=1 SV=1
3	A0A0C4DGU5	3.29e-92	270	231	0.736	0.567	A0A0C4DGU5_HUMAN Nucleolar protein 16 OS=Homo sapiens OX=9606 GN=NOP16 PE=1 SV=1
4	Q94402	9.00e-15	70.9	189	0.264	0.249	NOP16_CAEEL Nucleolar protein 16 OS=Caenorhabditis elegans OX=6239 GN=nol-16 PE=3 SV=1
5	Q9Y7Z1	0.15	34.3	209	0.096	0.081	NOP16_SCHPO Nucleolar protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nop16 PE=1 SV=1
6	A0A6M3VZT9	2.9	29.6	129	0.062	0.085	CAPS1_PFV2 Major capsid protein 1 OS=Pyrobaculum filamentous virus 2 OX=2730621 GN=PFV2_gp20 PE=1 SV=1
7	P40383	5.6	30.0	1328	0.096	0.013	XRN1_SCHPO 5'-3' exoribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exo2 PE=1 SV=1
8	P61407	5.9	30.0	2134	0.090	0.007	TDRD6_MOUSE Tudor domain-containing protein 6 OS=Mus musculus OX=10090 GN=Tdrd6 PE=1 SV=1
9	P51559	8.0	29.6	942	0.101	0.019	BLI4_CAEEL Endoprotease bli-4 OS=Caenorhabditis elegans OX=6239 GN=bli-4 PE=1 SV=3
10	Q57W06	8.7	28.9	191	0.079	0.073	Q57W06_TRYB2 Nucleolar protein 16 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.500 PE=3 SV=1
11	Q9P7R8	9.4	29.3	1462	0.169	0.021	YHV3_SCHPO Uncharacterized protein C211.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC211.03c PE=1 SV=1
12	P92199	9.5	29.3	1173	0.140	0.021	ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans OX=6239 GN=let-502 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05214 Baculo_p33	73	14.6	Baculovirus P33
2	PF20271 CATASP	42	15.5	CATRA-Associated Small Protein
3	PF09420 Nop16	3.8e-19	81.1	Ribosome biogenesis protein Nop16
4	PF05762 VWA_CoxE	2.2e+02	12.6	VWA domain containing CoxE-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480832

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364320	0.969	mRNA turnover protein 4 homolog
2	9606.ENSP00000254940	0.965	60S ribosome subunit biogenesis protein NIP7 homolog
3	9606.ENSP00000261015	0.951	Ribosome biogenesis protein WDR12
4	9606.ENSP00000285814	0.936	Nucleolar protein interacting with the FHA domain of MKI67
5	9606.ENSP00000259239	0.928	U3 small nucleolar ribonucleoprotein protein IMP4
6	9606.ENSP00000274606	0.926	H/ACA ribonucleoprotein complex subunit 2
7	9606.ENSP00000418221	0.919	Ribosomal protein L7 like 1
8	9606.ENSP00000326981	0.917	U3 small nucleolar ribonucleoprotein protein IMP3
9	9606.ENSP00000357748	0.912	BRCA2 and CDKN1A-interacting protein
10	9606.ENSP00000358563	0.893	H/ACA ribonucleoprotein complex subunit 4
11	9606.ENSP00000470560	0.890	Ribosomal RNA small subunit methyltransferase NEP1
12	9606.ENSP00000355899	0.884	RRP15-like protein
13	9606.ENSP00000322396	0.878	Ribosome biogenesis regulatory protein homolog
14	9606.ENSP00000383949	0.874	NHP2-like protein 1
15	9606.ENSP00000221801	0.864	rRNA 2'-O-methyltransferase fibrillarin
16	9606.ENSP00000407323	0.854	Probable rRNA-processing protein EBP2
17	9606.ENSP00000363384	0.851	Zinc finger protein 593
18	9606.ENSP00000405674	0.847	Nucleolar protein 7
19	9606.ENSP00000361092	0.840	Surfeit locus protein 6
20	9606.ENSP00000338862	0.838	Ribosome biogenesis protein BRX1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.872	protein binding
GO:0003824	0.341	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.971	biological regulation
GO:0022613	0.876	ribonucleoprotein complex biogenesis
GO:0050789	0.867	regulation of biological process
GO:0050794	0.826	regulation of cellular process
GO:0008152	0.780	metabolic process
GO:0071704	0.752	organic substance metabolic process
GO:0044237	0.735	cellular metabolic process
GO:0044238	0.734	primary metabolic process
GO:0006807	0.712	nitrogen compound metabolic process
GO:0043170	0.683	macromolecule metabolic process
GO:0042254	0.635	ribosome biogenesis
GO:0034641	0.479	cellular nitrogen compound metabolic process
GO:0006139	0.438	nucleobase-containing compound metabolic process
GO:0019222	0.419	regulation of metabolic process
GO:0048518	0.412	positive regulation of biological process
GO:0090304	0.401	nucleic acid metabolic process
GO:0060255	0.368	regulation of macromolecule metabolic process
GO:0080090	0.345	regulation of primary metabolic process
GO:0051171	0.342	regulation of nitrogen compound metabolic process
GO:0048522	0.317	positive regulation of cellular process
GO:0010467	0.309	gene expression
GO:0016043	0.306	cellular component organization
GO:0031323	0.302	regulation of cellular metabolic process
GO:0016070	0.300	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0005737	0.417	cytoplasm
GO:0032991	0.324	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]