StarFunc result for job id Q9Y3C5

User Input

>input (154 residues)
MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLAT
QLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHI
YHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QYK7	0.827	0.827	1.096E-29	154	0.994	0.994	Q9QYK7.pdb.gz	RNF11_MOUSE RING finger protein 11 OS=Mus musculus OX=10090 GN=Rnf11 PE=1 SV=1
2	AFDB:Q8SX35	0.546	0.570	7.662E-16	147	0.545	0.571	Q8SX35.pdb.gz	Q8SX35_DROME GEO07743p1 OS=Drosophila melanogaster OX=7227 GN=Rnf11 PE=2 SV=1
3	AFDB:Q8L649	0.419	0.264	8.847E-9	248	0.240	0.149	Q8L649.pdb.gz	BB_ARATH E3 ubiquitin-protein ligase BIG BROTHER OS=Arabidopsis thaliana OX=3702 GN=BB PE=1 SV=1
4	AFDB:Q9M622	0.450	0.232	4.440E-8	310	0.188	0.094	Q9M622.pdb.gz	RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=RMR1 PE=1 SV=1
5	AFDB:Q9H0F5	0.415	0.127	6.976E-8	515	0.286	0.085	Q9H0F5.pdb.gz	RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens OX=9606 GN=RNF38 PE=1 SV=4
6	AFDB:Q7L0R7	0.408	0.149	9.632E-8	432	0.260	0.093	Q7L0R7.pdb.gz	RNF44_HUMAN RING finger protein 44 OS=Homo sapiens OX=9606 GN=RNF44 PE=1 SV=1
7	AFDB:Q852U6	0.403	0.253	2.885E-7	250	0.195	0.120	Q852U6.pdb.gz	RHY1A_ARATH Probable E3 ubiquitin-protein ligase RHY1A OS=Arabidopsis thaliana OX=3702 GN=RHY1A PE=1 SV=1
8	AFDB:A0A024RDP2	0.398	0.093	3.283E-7	685	0.305	0.069	A0A024RDP2.pdb.gz	A0A024RDP2_HUMAN Ring finger protein 6 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RNF6 PE=2 SV=1
9	AFDB:Q9DBU5	0.391	0.094	5.867E-7	667	0.292	0.067	Q9DBU5.pdb.gz	RNF6_MOUSE E3 ubiquitin-protein ligase RNF6 OS=Mus musculus OX=10090 GN=Rnf6 PE=1 SV=1
10	AFDB:Q641J8	0.388	0.100	7.121E-7	622	0.247	0.061	Q641J8.pdb.gz	RF12A_XENLA E3 ubiquitin-protein ligase RNF12-A OS=Xenopus laevis OX=8355 GN=rnf12-a PE=1 SV=1
11	PDB:5a31B	0.285	0.501	2.285E-2	84	0.110	0.202	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
12	PDB:7oikA	0.282	0.011	4.958E-2	4426	0.136	0.005	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
13	PDB:8a3tU	0.279	0.370	1.305E-1	114	0.104	0.140	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
14	PDB:5gm6a	0.281	0.345	1.485E-1	123	0.078	0.098	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:2lgvA	0.266	0.399	2.050E-1	100	0.091	0.140	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
16	PDB:5dkaA	0.267	0.414	3.436E-1	96	0.084	0.135	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
17	PDB:7oniR	0.283	0.489	5.060E-1	86	0.078	0.140	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
18	PDB:2c2lA	0.254	0.144	6.141E-1	281	0.110	0.060	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
19	PDB:1mzgA	0.185	0.195	1.617	144	0.065	0.069	1mzgA.pdb.gz
20	PDB:5lj5t	0.244	0.092	1.725	438	0.078	0.027	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y3C5	8.69e-114	320	154	1.000	1.000	RNF11_HUMAN RING finger protein 11 OS=Homo sapiens OX=9606 GN=RNF11 PE=1 SV=1
2	Q9QYK7	1.61e-113	320	154	0.994	0.994	RNF11_MOUSE RING finger protein 11 OS=Mus musculus OX=10090 GN=Rnf11 PE=1 SV=1
3	Q8SX35	6.51e-51	161	147	0.532	0.558	Q8SX35_DROME GEO07743p1 OS=Drosophila melanogaster OX=7227 GN=Rnf11 PE=2 SV=1
4	A0A024RDP2	2.47e-12	65.5	685	0.149	0.034	A0A024RDP2_HUMAN Ring finger protein 6 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RNF6 PE=2 SV=1
5	Q9Y252	2.47e-12	65.5	685	0.149	0.034	RNF6_HUMAN E3 ubiquitin-protein ligase RNF6 OS=Homo sapiens OX=9606 GN=RNF6 PE=1 SV=1
6	Q9DBU5	7.50e-12	64.3	667	0.143	0.033	RNF6_MOUSE E3 ubiquitin-protein ligase RNF6 OS=Mus musculus OX=10090 GN=Rnf6 PE=1 SV=1
7	Q9LM69	1.16e-11	62.0	197	0.201	0.157	ATL80_ARATH RING-H2 finger protein ATL80 OS=Arabidopsis thaliana OX=3702 GN=ATL80 PE=2 SV=1
8	O22755	1.64e-11	61.2	185	0.182	0.151	ATL44_ARATH Probable E3 ubiquitin-protein ligase ATL44 OS=Arabidopsis thaliana OX=3702 GN=ATL44 PE=1 SV=1
9	Q641J8	6.40e-11	61.6	622	0.136	0.034	RF12A_XENLA E3 ubiquitin-protein ligase RNF12-A OS=Xenopus laevis OX=8355 GN=rnf12-a PE=1 SV=1
10	Q9NVW2	6.40e-11	61.6	624	0.143	0.035	RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens OX=9606 GN=RLIM PE=1 SV=3
11	Q9H0F5	9.70e-11	60.8	515	0.195	0.058	RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens OX=9606 GN=RNF38 PE=1 SV=4
12	Q9WTV7	9.81e-11	60.8	600	0.136	0.035	RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus OX=10090 GN=Rlim PE=1 SV=2
13	A0A8I5XVZ9	1.25e-10	60.5	526	0.195	0.057	A0A8I5XVZ9_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
14	Q3U2C5	1.38e-10	60.5	394	0.188	0.074	RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus OX=10090 GN=Rnf149 PE=1 SV=3
15	A0A8I5ZQX4	1.55e-10	60.5	514	0.195	0.058	A0A8I5ZQX4_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
16	Q5XIX1	1.70e-10	60.1	432	0.195	0.069	Q5XIX1_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
17	A0A8I5ZJ72	1.89e-10	60.1	577	0.195	0.052	A0A8I5ZJ72_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
18	A0A0G2K236	2.08e-10	60.1	573	0.195	0.052	A0A0G2K236_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
19	A0A0G2K8H9	2.09e-10	60.1	623	0.195	0.048	A0A0G2K8H9_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
20	Q9FLC6	2.27e-10	58.2	176	0.149	0.131	ATL73_ARATH RING-H2 finger protein ATL73 OS=Arabidopsis thaliana OX=3702 GN=ATL73 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	1.6	19.9	Prokaryotic RING finger family 4
2	PF17122 zf-C3H2C3	7.6e+02	11.6	Zinc-finger
3	PF00097 zf-C3HC4	0.02	26.1	Zinc finger, C3HC4 type (RING finger)
4	PF13923 zf-C3HC4_2	0.003	28.7	Zinc finger, C3HC4 type (RING finger)
5	PF13920 zf-C3HC4_3	0.015	26.5	Zinc finger, C3HC4 type (RING finger)
6	PF12678 zf-rbx1	0.024	26.3	RING-H2 zinc finger domain
7	PF17123 zf-RING_11	1.3e-07	42.5	RING-like zinc finger
8	PF17120 zf-RING_16	0.32	21.9	RING/Ubox like zinc-binding domain
9	PF13639 zf-RING_2	2.4e-08	45.5	Ring finger domain
10	PF14634 zf-RING_5	0.052	24.8	zinc-RING finger domain
11	PF14835 zf-RING_6	5.5e+02	11.8	zf-RING of BARD1-type protein
12	PF13445 zf-RING_UBOX	0.00038	31.7	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008826683.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008820266.1	0.861	Tumor necrosis factor alpha-induced protein 3
2	1026970.XP_008839828.1	0.849	SMAD specific E3 ubiquitin protein ligase 2
3	1026970.XP_008839740.1	0.847	Tax1 binding protein 1
4	1026970.XP_008831354.1	0.817	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: added 145 bases not found in genome assembly
5	1026970.XP_008846115.1	0.817	E3 ubiquitin-protein ligase Itchy-like
6	1026970.XP_008836168.1	0.782	Signal transducing adapter molecule 2 isoform X1
7	1026970.XP_008822470.1	0.733	SMAD family member 4
8	1026970.XP_008822026.1	0.730	Ubiquitin conjugating enzyme E2 N
9	1026970.XP_008843971.1	0.730	Ubiquitin-conjugating enzyme E2 N-like
10	1026970.XP_008821728.1	0.699	E3 ubiquitin-protein ligase makorin-1 isoform X1
11	1026970.XP_008822193.1	0.662	Nuclear factor of activated T-cells 2 interacting protein
12	1026970.XP_008851087.1	0.657	STAM binding protein
13	1026970.XP_008822255.1	0.656	SMAD specific E3 ubiquitin protein ligase 1
14	1026970.XP_008843295.1	0.646	Nitric oxide synthase interacting protein
15	1026970.XP_008826658.1	0.644	Zinc finger FYVE domain-containing protein 9 isoform X1
16	1026970.XP_008827231.1	0.634	Ubiquitin conjugating enzyme E2 D1
17	1026970.XP_008827684.1	0.609	WW domain containing E3 ubiquitin protein ligase 1
18	1026970.XP_008835438.1	0.576	Cell division cycle 34
19	1026970.XP_008850608.1	0.576	TNF receptor-associated factor 6
20	1026970.XP_008822326.1	0.575	Signal transducing adapter molecule 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	0.998	ubiquitin-protein transferase activity
GO:0061630	0.565	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006511	0.995	ubiquitin-dependent protein catabolic process
GO:0043412	0.762	macromolecule modification
GO:0036211	0.723	protein modification process
GO:0032446	0.585	protein modification by small protein conjugation
GO:0016567	0.580	protein ubiquitination
GO:0050794	0.360	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.998	catalytic complex
GO:0140535	0.997	intracellular protein-containing complex
GO:0000151	0.993	ubiquitin ligase complex
GO:0110165	0.992	cellular anatomical entity
GO:0043227	0.969	membrane-bounded organelle
GO:0005622	0.894	intracellular anatomical structure
GO:0043231	0.824	intracellular membrane-bounded organelle
GO:0031982	0.821	vesicle
GO:0005576	0.817	extracellular region
GO:0005737	0.795	cytoplasm
GO:0070062	0.784	extracellular exosome
GO:0031974	0.504	membrane-enclosed lumen
GO:0070013	0.472	intracellular organelle lumen
GO:0005829	0.433	cytosol
GO:0031981	0.429	nuclear lumen
GO:0005654	0.360	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]