StarFunc result for job id Q9Y3C7

User Input

>input (131 residues)
MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKD
PEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALA
EQQQQNNTSGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A7J4	0.999	0.999	1.240E-18	131	0.977	0.977	D4A7J4.pdb.gz	D4A7J4_RAT Mediator of RNA polymerase II transcription subunit 31 OS=Rattus norvegicus OX=10116 GN=Med31 PE=3 SV=1
2	AFDB:Q8IH24	0.730	0.475	4.129E-12	204	0.588	0.377	Q8IH24.pdb.gz	MED31_DROME Mediator of RNA polymerase II transcription subunit 31 OS=Drosophila melanogaster OX=7227 GN=MED31 PE=1 SV=2
3	PDB:7lbmy	0.676	0.757	5.395E-12	116	0.878	0.991	7lbmy.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
4	AFDB:Q8VYB1	0.768	0.516	1.660E-9	196	0.389	0.260	Q8VYB1.pdb.gz	MED31_ARATH Mediator of RNA polymerase II transcription subunit 31 OS=Arabidopsis thaliana OX=3702 GN=MED31 PE=1 SV=1
5	AFDB:Q59P87	0.718	0.646	3.040E-9	146	0.366	0.329	Q59P87.pdb.gz	MED31_CANAL Mediator of RNA polymerase II transcription subunit 31 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SOH1 PE=3 SV=1
6	AFDB:Q9USH1	0.697	0.658	2.746E-8	139	0.351	0.331	Q9USH1.pdb.gz	MED31_SCHPO Mediator of RNA polymerase II transcription subunit 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med31 PE=1 SV=1
7	AFDB:P38633	0.491	0.506	1.113E-4	127	0.290	0.299	P38633.pdb.gz	MED31_YEAST Mediator of RNA polymerase II transcription subunit 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SOH1 PE=1 SV=1
8	PDB:3fbiD	0.463	0.636	8.000E-4	94	0.244	0.340	3fbiD.pdb.gz
9	PDB:5oqmo	0.480	0.622	3.165E-3	99	0.267	0.354	5oqmo.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
10	AFDB:Q1ZXL0	0.199	0.050	1.688	808	0.168	0.027	Q1ZXL0.pdb.gz	Y5795_DICDI PH domain-containing protein DDB_G0275795 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275795 PE=4 SV=1
11	AFDB:Q16630	0.220	0.084	1.885	551	0.130	0.031	Q16630.pdb.gz	CPSF6_HUMAN Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2
12	PDB:6wr4A	0.207	0.076	2.602	470	0.122	0.034	6wr4A.pdb.gz	Structure of Human ATG9A, the Only Transmembrane Protein of the Core Autophagy Machinery.
13	AFDB:Q5ADY1	0.248	0.092	2.622	445	0.069	0.020	Q5ADY1.pdb.gz	Q5ADY1_CANAL Utp9p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTP9 PE=4 SV=1
14	AFDB:A0A0H3L7S1	0.225	0.285	2.770	98	0.115	0.153	A0A0H3L7S1.pdb.gz	A0A0H3L7S1_MYCTE ESAT-6-like protein OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=esxK PE=3 SV=1
15	PDB:3j9xA	0.209	0.213	2.904	128	0.099	0.102	3j9xA.pdb.gz	A virus that infects a hyperthermophile encapsidates A-form DNA.
16	PDB:1f6gA	0.171	0.149	3.242	160	0.214	0.175	1f6gA.pdb.gz
17	PDB:6yxxA2	0.221	0.082	4.268	463	0.099	0.028	6yxxA2.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
18	PDB:6ah0u	0.172	0.180	5.034	124	0.099	0.105	6ah0u.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
19	PDB:3iqcA	0.227	0.241	5.319	119	0.092	0.101	3iqcA.pdb.gz
20	PDB:5fl1A	0.142	0.054	5.319	703	0.099	0.018	5fl1A.pdb.gz	Analysis of transition state mimicry by tight binding aminothiazoline inhibitors provides insight into catalysis by humanO-GlcNAcase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y3C7	8.07e-95	270	131	1.000	1.000	MED31_HUMAN Mediator of RNA polymerase II transcription subunit 31 OS=Homo sapiens OX=9606 GN=MED31 PE=1 SV=1
2	Q9CXU1	6.10e-93	266	131	0.977	0.977	MED31_MOUSE Mediator of RNA polymerase II transcription subunit 31 OS=Mus musculus OX=10090 GN=Med31 PE=1 SV=2
3	D4A7J4	6.96e-93	266	131	0.977	0.977	D4A7J4_RAT Mediator of RNA polymerase II transcription subunit 31 OS=Rattus norvegicus OX=10116 GN=Med31 PE=3 SV=1
4	Q8IH24	1.19e-56	176	204	0.588	0.377	MED31_DROME Mediator of RNA polymerase II transcription subunit 31 OS=Drosophila melanogaster OX=7227 GN=MED31 PE=1 SV=2
5	Q8VYB1	5.48e-33	116	196	0.397	0.265	MED31_ARATH Mediator of RNA polymerase II transcription subunit 31 OS=Arabidopsis thaliana OX=3702 GN=MED31 PE=1 SV=1
6	Q9USH1	1.44e-29	105	139	0.351	0.331	MED31_SCHPO Mediator of RNA polymerase II transcription subunit 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med31 PE=1 SV=1
7	Q59P87	5.86e-29	104	146	0.351	0.315	MED31_CANAL Mediator of RNA polymerase II transcription subunit 31 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SOH1 PE=3 SV=1
8	P38633	3.11e-14	66.2	127	0.260	0.268	MED31_YEAST Mediator of RNA polymerase II transcription subunit 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SOH1 PE=1 SV=1
9	Q95SQ7	1.9	30.4	445	0.160	0.047	Q95SQ7_DROME GH07831p OS=Drosophila melanogaster OX=7227 GN=CG9175 PE=2 SV=1
10	Q9VMH4	1.9	30.4	445	0.160	0.047	Q9VMH4_DROME FI09914p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9175 PE=2 SV=1
11	Q4WI55	3.6	29.6	3170	0.099	0.004	Q4WI55_ASPFU Pre-mRNA splicing factor (Prp8), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G03030 PE=4 SV=1
12	Q8SZZ8	5.0	29.3	684	0.092	0.018	ICE2_DROME Little elongation complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=Ice2 PE=1 SV=1
13	A0A8I6AB98	5.4	29.3	1944	0.122	0.008	A0A8I6AB98_RAT Tumor protein p53 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53bp1 PE=1 SV=1
14	A0A8I6AKV2	5.4	29.3	1932	0.122	0.008	A0A8I6AKV2_RAT Tumor protein p53 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53bp1 PE=1 SV=1
15	A6NNK5	5.4	29.3	1927	0.122	0.008	A6NNK5_HUMAN Tumor protein p53 binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2
16	F1M842	5.4	29.3	1972	0.122	0.008	F1M842_RAT Tumor protein p53 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53bp1 PE=1 SV=3
17	P70399	5.4	29.3	1969	0.122	0.008	TP53B_MOUSE TP53-binding protein 1 OS=Mus musculus OX=10090 GN=Tp53bp1 PE=1 SV=3
18	Q12888	5.4	29.3	1972	0.122	0.008	TP53B_HUMAN TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2
19	P28286	7.9	28.5	617	0.137	0.029	5HT2B_DROME 5-hydroxytryptamine receptor 2B OS=Drosophila melanogaster OX=7227 GN=5-HT1B PE=2 SV=3
20	Q9XXT5	9.2	28.5	794	0.122	0.020	Q9XXT5_CAEEL LNS2/PITP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lpin-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05669 Med31	3.4e-37	137.6	SOH1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011261

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004752	0.997	Mediator of RNA polymerase II transcription subunit 7
2	61853.ENSNLEP00000013783	0.997	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
3	61853.ENSNLEP00000002236	0.996	Mediator complex subunit 6
4	61853.ENSNLEP00000006572	0.996	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
5	61853.ENSNLEP00000002188	0.994	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
6	61853.ENSNLEP00000011923	0.994	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
7	61853.ENSNLEP00000015585	0.991	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
8	61853.ENSNLEP00000023696	0.984	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
9	61853.ENSNLEP00000020163	0.981	Mediator complex subunit 28
10	61853.ENSNLEP00000015556	0.980	Cyclin-dependent kinase 19
11	61853.ENSNLEP00000016790	0.980	Cyclin C
12	61853.ENSNLEP00000017049	0.979	Cyclin-dependent kinase 8
13	61853.ENSNLEP00000000991	0.978	Mediator of RNA polymerase II transcription subunit 1
14	61853.ENSNLEP00000003648	0.976	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
15	61853.ENSNLEP00000005897	0.972	Mediator complex subunit 30
16	61853.ENSNLEP00000016487	0.970	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
17	61853.ENSNLEP00000016423	0.968	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
18	61853.ENSNLEP00000000701	0.966	Mediator of RNA polymerase II transcription subunit 13
19	61853.ENSNLEP00000000301	0.957	Mediator of RNA polymerase II transcription subunit 13
20	61853.ENSNLEP00000006731	0.947	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.707	catalytic activity
GO:0016740	0.430	transferase activity
GO:0061630	0.331	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0050789	0.977	regulation of biological process
GO:0006807	0.975	nitrogen compound metabolic process
GO:0050794	0.972	regulation of cellular process
GO:0043170	0.961	macromolecule metabolic process
GO:1901564	0.634	organonitrogen compound metabolic process
GO:0036211	0.618	protein modification process
GO:0019222	0.542	regulation of metabolic process
GO:0031323	0.529	regulation of cellular metabolic process
GO:0051171	0.479	regulation of nitrogen compound metabolic process
GO:0070647	0.469	protein modification by small protein conjugation or removal
GO:0009987	0.465	cellular process
GO:0016567	0.449	protein ubiquitination
GO:0060255	0.425	regulation of macromolecule metabolic process
GO:0080090	0.423	regulation of primary metabolic process
GO:0032502	0.418	developmental process
GO:0010468	0.413	regulation of gene expression
GO:0019219	0.400	regulation of nucleobase-containing compound metabolic process
GO:0032501	0.388	multicellular organismal process
GO:0051252	0.364	regulation of RNA metabolic process
GO:0048856	0.355	anatomical structure development
GO:0048518	0.351	positive regulation of biological process
GO:0006355	0.351	regulation of DNA-templated transcription
GO:0044237	0.328	cellular metabolic process
GO:0048522	0.320	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0090575	0.967	RNA polymerase II transcription regulator complex
GO:0070847	0.925	core mediator complex
GO:0140535	0.890	intracellular protein-containing complex
GO:1990234	0.890	transferase complex
GO:0000151	0.317	ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.430	Transferases.

[back to server]