StarFunc result for job id Q9Y3D2

User Input

>input (182 residues)
MARLLWLLRGLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTP
EQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTS
GSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPR
KH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y3D2	1.000	1.000	8.988E-35	182	1.000	1.000	Q9Y3D2.pdb.gz	MSRB2_HUMAN Methionine-R-sulfoxide reductase B2, mitochondrial OS=Homo sapiens OX=9606 GN=MSRB2 PE=1 SV=2
2	AFDB:Q78J03	0.773	0.803	8.211E-29	175	0.764	0.794	Q78J03.pdb.gz	MSRB2_MOUSE Methionine-R-sulfoxide reductase B2, mitochondrial OS=Mus musculus OX=10090 GN=Msrb2 PE=1 SV=1
3	AFDB:Q0DC89	0.672	0.573	1.324E-19	214	0.429	0.364	Q0DC89.pdb.gz	MSRB1_ORYSJ Peptide methionine sulfoxide reductase B1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=MSRB1 PE=1 SV=2
4	AFDB:Q5TZH6	0.675	0.661	1.403E-19	186	0.390	0.382	Q5TZH6.pdb.gz	Q5TZH6_DANRE Peptide-methionine (R)-S-oxide reductase OS=Danio rerio OX=7955 GN=wu:fc07g04 PE=3 SV=1
5	AFDB:F6P046	0.669	0.610	1.488E-19	200	0.407	0.370	F6P046.pdb.gz
6	AFDB:Q9C8M2	0.683	0.619	7.200E-19	202	0.407	0.366	Q9C8M2.pdb.gz	MSRB1_ARATH Peptide methionine sulfoxide reductase B1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MSRB1 PE=1 SV=1
7	AFDB:Q5TZH8	0.676	0.660	8.092E-19	187	0.390	0.380	Q5TZH8.pdb.gz	Q5TZH8_DANRE Peptide-methionine (R)-S-oxide reductase OS=Danio rerio OX=7955 GN=wu:fc07g04 PE=3 SV=1
8	AFDB:Q8IXL7	0.664	0.630	2.315E-18	192	0.418	0.396	Q8IXL7.pdb.gz	MSRB3_HUMAN Methionine-R-sulfoxide reductase B3 OS=Homo sapiens OX=9606 GN=MSRB3 PE=1 SV=2
9	AFDB:Q8INK9	0.675	0.592	5.245E-18	208	0.374	0.327	Q8INK9.pdb.gz	MSRB_DROME Methionine-R-sulfoxide reductase B1 OS=Drosophila melanogaster OX=7227 GN=SelR PE=1 SV=3
10	AFDB:Q9I016	0.679	0.933	1.501E-17	132	0.346	0.477	Q9I016.pdb.gz	MSRB_PSEAE Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=msrB PE=3 SV=1
11	PDB:6symA	0.645	0.863	1.966E-17	135	0.357	0.481	6symA.pdb.gz	Structure of Peptide methionine sulfoxide reductase MsrB at 1.63 Angstrom resolution
12	PDB:2kv1A	0.389	0.531	2.683E-6	124	0.187	0.274	2kv1A.pdb.gz
13	PDB:5fqdE	0.349	0.183	1.389E-3	367	0.104	0.052	5fqdE.pdb.gz	Structural Basis of Lenalidomide-Induced Ck1Alpha Degradation by the Crl4(Crbn) Ubiquitin Ligase.
14	PDB:6h0gB	0.345	0.167	1.860E-3	401	0.104	0.047	6h0gB.pdb.gz	Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN.
15	PDB:7bkpA	0.383	0.115	9.001E-3	689	0.088	0.023	7bkpA.pdb.gz	MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
16	PDB:6h61A	0.332	0.104	2.429E-2	660	0.077	0.021	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
17	PDB:7tnxA	0.305	0.100	9.868E-2	647	0.066	0.019	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
18	PDB:6f5dA	0.123	0.056	4.505E-1	524	0.049	0.017	6f5dA.pdb.gz	ATP synthase fromTrypanosoma bruceihas an elaborated canonical F1-domain and conventional catalytic sites.
19	PDB:6o9l1	0.144	0.065	7.621E-1	546	0.044	0.015	6o9l1.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
20	PDB:1fwqA	0.299	0.445	8.079E-1	115	0.082	0.130	1fwqA.pdb.gz	Structure of guanine-nucleotide-exchange factor human Mss4 and identification of its Rab-interacting surface.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y3D2	4.56e-134	374	182	1.000	1.000	MSRB2_HUMAN Methionine-R-sulfoxide reductase B2, mitochondrial OS=Homo sapiens OX=9606 GN=MSRB2 PE=1 SV=2
2	Q78J03	1.03e-95	276	175	0.764	0.794	MSRB2_MOUSE Methionine-R-sulfoxide reductase B2, mitochondrial OS=Mus musculus OX=10090 GN=Msrb2 PE=1 SV=1
3	Q9C8M2	1.59e-44	148	202	0.379	0.342	MSRB1_ARATH Peptide methionine sulfoxide reductase B1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MSRB1 PE=1 SV=1
4	Q0DC89	5.84e-44	147	214	0.379	0.322	MSRB1_ORYSJ Peptide methionine sulfoxide reductase B1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=MSRB1 PE=1 SV=2
5	P0A746	2.00e-41	138	137	0.374	0.496	MSRB_ECOLI Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain K12) OX=83333 GN=msrB PE=1 SV=1
6	Q5TZH6	4.98e-41	138	186	0.357	0.349	Q5TZH6_DANRE Peptide-methionine (R)-S-oxide reductase OS=Danio rerio OX=7955 GN=wu:fc07g04 PE=3 SV=1
7	Q5TZH8	9.41e-41	137	187	0.357	0.348	Q5TZH8_DANRE Peptide-methionine (R)-S-oxide reductase OS=Danio rerio OX=7955 GN=wu:fc07g04 PE=3 SV=1
8	Q8IXL7	3.32e-40	136	192	0.368	0.349	MSRB3_HUMAN Methionine-R-sulfoxide reductase B3 OS=Homo sapiens OX=9606 GN=MSRB3 PE=1 SV=2
9	Q9I016	4.52e-37	126	132	0.352	0.485	MSRB_PSEAE Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=msrB PE=3 SV=1
10	P71971	6.27e-35	121	136	0.330	0.441	P71971_MYCTO peptide-methionine (R)-S-oxide reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2748 PE=4 SV=1
11	Q8INK9	1.08e-33	120	208	0.341	0.298	MSRB_DROME Methionine-R-sulfoxide reductase B1 OS=Drosophila melanogaster OX=7227 GN=SelR PE=1 SV=3
12	P25566	1.74e-27	103	168	0.308	0.333	MXR2_YEAST Peptide methionine sulfoxide reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MXR2 PE=1 SV=1
13	Q9M0Z6	5.51e-27	102	176	0.319	0.330	MSRB3_ARATH Peptide methionine sulfoxide reductase B3 OS=Arabidopsis thaliana OX=3702 GN=MSRB3 PE=2 SV=2
14	Q9C5C8	6.00e-24	95.1	202	0.313	0.282	MSRB2_ARATH Peptide methionine sulfoxide reductase B2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MSRB2 PE=1 SV=1
15	Q84JT6	1.12e-22	90.5	143	0.280	0.357	MSRB9_ARATH Peptide methionine sulfoxide reductase B9 OS=Arabidopsis thaliana OX=3702 GN=MSRB9 PE=2 SV=1
16	Q8VY86	6.63e-22	88.2	144	0.286	0.361	MSRB7_ARATH Peptide methionine sulfoxide reductase B7 OS=Arabidopsis thaliana OX=3702 GN=MSRB7 PE=2 SV=1
17	Q9Y7K1	5.52e-21	85.9	138	0.286	0.377	YGL4_SCHPO Uncharacterized protein C216.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC216.04c PE=3 SV=1
18	Q9NZV6	4.36e-12	62.0	116	0.214	0.336	MSRB1_HUMAN Methionine-R-sulfoxide reductase B1 OS=Homo sapiens OX=9606 GN=MSRB1 PE=1 SV=3
19	Q9JLC3	4.72e-10	56.6	116	0.192	0.302	MSRB1_MOUSE Methionine-R-sulfoxide reductase B1 OS=Mus musculus OX=10090 GN=Msrb1 PE=1 SV=3
20	A8MYR2	0.006	38.5	226	0.088	0.071	A8MYR2_HUMAN L-methionine (R)-S-oxide reductase OS=Homo sapiens OX=9606 GN=MSRB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09814 HECT_2	1.7e+02	12.5	HECT-like Ubiquitin-conjugating enzyme (E2)-binding
2	PF01641 SelR	8.2e-47	169.6	SelR domain
3	PF10058 zinc_ribbon_10	4.2e+02	12.1	Predicted integral membrane zinc-ribbon metal-binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365693

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313921	0.993	Mitochondrial peptide methionine sulfoxide reductase
2	9606.ENSP00000363641	0.964	Thioredoxin
3	9606.ENSP00000381234	0.689	annotation not available
4	9606.ENSP00000434516	0.646	Thioredoxin reductase 1, cytoplasmic
5	9606.ENSP00000381231	0.627	Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L- homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
6	9606.ENSP00000361522	0.601	Tight junction associated protein 1
7	9606.ENSP00000369314	0.562	Glutaredoxin-1
8	9606.ENSP00000354006	0.552	Transient receptor potential cation channel subfamily M member 6
9	9606.ENSP00000339867	0.528	Chloride channel protein 1
10	9606.ENSP00000396755	0.511	Cyclin N-terminal domain containing 2
11	9606.ENSP00000355141	0.508	Selenoprotein N
12	9606.ENSP00000398744	0.507	Adenosine deaminase-like protein
13	9606.ENSP00000260585	0.506	Ethanolaminephosphotransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0033743	1.000	peptide-methionine (R)-S-oxide reductase activity
GO:0046872	0.834	metal ion binding
GO:0046914	0.805	transition metal ion binding
GO:0008270	0.610	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.995	metabolic process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0006807	0.977	nitrogen compound metabolic process
GO:1901564	0.971	organonitrogen compound metabolic process
GO:0043170	0.962	macromolecule metabolic process
GO:0019538	0.920	protein metabolic process
GO:0009987	0.804	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.993	cytosol
GO:0043231	0.940	intracellular membrane-bounded organelle
GO:0070013	0.589	intracellular organelle lumen
GO:0005739	0.438	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24164	1.000	[thioredoxin]-disulfide + H2O + L-methionyl-[protein] = [thioredoxin]-dithiol + L-methionyl-(R)-S-oxide-[protein]
EC:1.8.4.12	1.000	peptide-methionine (R)-S-oxide reductase.

[back to server]