StarFunc result for job id Q9Y3D7

User Input

>input (125 residues)
MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQ
QILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKG
QMPHT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZZV1	0.954	0.954	1.018E-16	125	0.952	0.952	D3ZZV1.pdb.gz	D3ZZV1_RAT Presequence translocase associated motor 16 OS=Rattus norvegicus OX=10116 GN=Pam16 PE=3 SV=1
2	AFDB:Q9VF08	0.607	0.553	1.485E-9	141	0.536	0.475	Q9VF08.pdb.gz	TIM16_DROME Mitochondrial import inner membrane translocase subunit Tim16 OS=Drosophila melanogaster OX=7227 GN=blp PE=2 SV=1
3	AFDB:Q9C1W5	0.532	0.520	1.158E-5	128	0.352	0.344	Q9C1W5.pdb.gz	TIM16_SCHPO Mitochondrial import inner membrane translocase subunit tim16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pam16 PE=3 SV=1
4	AFDB:P42949	0.564	0.477	1.374E-5	149	0.384	0.322	P42949.pdb.gz	TIM16_YEAST Mitochondrial import inner membrane translocase subunit TIM16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAM16 PE=1 SV=1
5	AFDB:Q93W66	0.488	0.537	5.009E-4	113	0.344	0.381	Q93W66.pdb.gz	TM16A_ARATH Mitochondrial import inner membrane translocase subunit PAM16 like 1 OS=Arabidopsis thaliana OX=3702 GN=PAM16L1 PE=2 SV=1
6	AFDB:Q93VV9	0.398	0.427	1.179E-3	116	0.400	0.431	Q93VV9.pdb.gz	TM16B_ARATH Mitochondrial import inner membrane translocase subunit PAM16 like 2 OS=Arabidopsis thaliana OX=3702 GN=PAM16L2 PE=2 SV=1
7	AFDB:Q78YY6	0.402	0.339	1.156E-2	149	0.224	0.188	Q78YY6.pdb.gz	DJC15_MOUSE DnaJ homolog subfamily C member 15 OS=Mus musculus OX=10090 GN=Dnajc15 PE=1 SV=1
8	AFDB:Q57VQ3	0.389	0.106	1.933E-2	490	0.144	0.037	Q57VQ3.pdb.gz	Q57VQ3_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.50 PE=4 SV=1
9	AFDB:Q07914	0.411	0.308	2.046E-2	168	0.128	0.095	Q07914.pdb.gz	TIM14_YEAST Mitochondrial import inner membrane translocase subunit TIM14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAM18 PE=1 SV=1
10	AFDB:Q6DDA1	0.404	0.341	2.167E-2	149	0.192	0.161	Q6DDA1.pdb.gz	DJC15_XENTR DnaJ homolog subfamily C member 15 OS=Xenopus tropicalis OX=8364 GN=dnajc15 PE=2 SV=1
11	PDB:4v6xCh	0.270	0.274	1.200	123	0.112	0.114	4v6xCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
12	PDB:7odrY	0.259	0.197	1.790	181	0.128	0.088	7odrY.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
13	PDB:7abzQ	0.225	0.235	2.381	117	0.160	0.171	7abzQ.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
14	PDB:3f51A	0.204	0.251	2.521	94	0.128	0.170	3f51A.pdb.gz
15	PDB:6wgeC	0.315	0.237	3.759	174	0.088	0.063	6wgeC.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
16	PDB:7eivB	0.276	0.146	3.980	300	0.096	0.040	7eivB.pdb.gz	X-shaped structure of bacterial heterotetrameric tRNA synthetase suggests cryptic prokaryote functions and a rationale for synthetase classifications.
17	PDB:3nd2A	0.298	0.053	4.213	861	0.080	0.012	3nd2A.pdb.gz
18	PDB:1fpoA	0.225	0.187	4.461	171	0.064	0.047	1fpoA.pdb.gz
19	PDB:5eutA	0.167	0.057	4.461	485	0.064	0.016	5eutA.pdb.gz
20	PDB:6hd7t	0.210	0.047	4.461	838	0.120	0.018	6hd7t.pdb.gz	Ribosome-NatA architecture reveals that rRNA expansion segments coordinate N-terminal acetylation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y3D7	1.46e-87	251	125	1.000	1.000	TIM16_HUMAN Mitochondrial import inner membrane translocase subunit TIM16 OS=Homo sapiens OX=9606 GN=PAM16 PE=1 SV=2
2	D3ZZV1	5.99e-72	212	125	0.952	0.952	D3ZZV1_RAT Presequence translocase associated motor 16 OS=Rattus norvegicus OX=10116 GN=Pam16 PE=3 SV=1
3	Q9CQV1	7.62e-72	212	125	0.960	0.960	TIM16_MOUSE Mitochondrial import inner membrane translocase subunit TIM16 OS=Mus musculus OX=10090 GN=Pam16 PE=1 SV=1
4	A0A8I5ZMD9	1.44e-66	198	119	0.896	0.941	A0A8I5ZMD9_RAT Presequence translocase associated motor 16 OS=Rattus norvegicus OX=10116 GN=Pam16 PE=1 SV=1
5	A0A8I6AUB7	3.25e-52	163	137	0.624	0.569	A0A8I6AUB7_RAT Presequence translocase associated motor 16 OS=Rattus norvegicus OX=10116 GN=Pam16 PE=1 SV=1
6	Q9VF08	3.70e-39	130	141	0.552	0.489	TIM16_DROME Mitochondrial import inner membrane translocase subunit Tim16 OS=Drosophila melanogaster OX=7227 GN=blp PE=2 SV=1
7	P42949	4.13e-22	87.0	149	0.376	0.315	TIM16_YEAST Mitochondrial import inner membrane translocase subunit TIM16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAM16 PE=1 SV=1
8	Q9C1W5	1.24e-18	77.4	128	0.392	0.383	TIM16_SCHPO Mitochondrial import inner membrane translocase subunit tim16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pam16 PE=3 SV=1
9	Q93VV9	2.15e-14	66.2	116	0.392	0.422	TM16B_ARATH Mitochondrial import inner membrane translocase subunit PAM16 like 2 OS=Arabidopsis thaliana OX=3702 GN=PAM16L2 PE=2 SV=1
10	Q93W66	5.64e-13	62.4	113	0.368	0.407	TM16A_ARATH Mitochondrial import inner membrane translocase subunit PAM16 like 1 OS=Arabidopsis thaliana OX=3702 GN=PAM16L1 PE=2 SV=1
11	G5EFG0	0.023	35.8	685	0.272	0.050	G5EFG0_CAEEL S5 DRBM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sel-1 PE=1 SV=1
12	Q07914	0.046	34.3	168	0.248	0.185	TIM14_YEAST Mitochondrial import inner membrane translocase subunit TIM14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAM18 PE=1 SV=1
13	Q9UT37	0.17	32.7	140	0.176	0.157	TIM14_SCHPO Mitochondrial import inner membrane translocase subunit tim14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pam18 PE=3 SV=1
14	P91454	0.50	30.8	112	0.136	0.152	TIM14_CAEEL Mitochondrial import inner membrane translocase subunit TIM14 OS=Caenorhabditis elegans OX=6239 GN=dnj-21 PE=3 SV=1
15	Q66GS9	0.85	31.2	1140	0.176	0.019	CP135_HUMAN Centrosomal protein of 135 kDa OS=Homo sapiens OX=9606 GN=CEP135 PE=1 SV=2
16	Q5SWU9	2.0	30.4	2345	0.168	0.009	ACACA_MOUSE Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1
17	Q78YY6	2.4	29.3	149	0.152	0.128	DJC15_MOUSE DnaJ homolog subfamily C member 15 OS=Mus musculus OX=10090 GN=Dnajc15 PE=1 SV=1
18	A4QNW2	4.8	29.3	969	0.176	0.023	A4QNW2_DANRE Centrosomal protein of 128 kDa OS=Danio rerio OX=7955 GN=cep128 PE=2 SV=1
19	Q13085	6.4	28.9	2346	0.160	0.009	ACACA_HUMAN Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2
20	Q6UD73	6.7	28.5	620	0.152	0.031	LYK3_MEDTR LysM domain receptor-like kinase 3 OS=Medicago truncatula OX=3880 GN=LYK3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02022 Integrase_Zn	9.5e+02	11.2	Integrase Zinc binding domain
2	PF03656 Pam16	1.1e-58	208.2	Pam16
3	PF15301 SLAIN	76	14.2	SLAIN motif-containing family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315693

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270538	0.999	Mitochondrial import inner membrane translocase subunit TIM44
2	9606.ENSP00000372005	0.999	Mitochondrial import inner membrane translocase subunit TIM14
3	9606.ENSP00000297185	0.995	Stress-70 protein, mitochondrial
4	9606.ENSP00000356256	0.995	Mitochondrial import inner membrane translocase subunit Tim17-A
5	9606.ENSP00000445806	0.986	Mitochondrial import inner membrane translocase subunit TIM50
6	9606.ENSP00000264954	0.984	GrpE protein homolog 1, mitochondrial
7	9606.ENSP00000464522	0.983	Mitochondrial import inner membrane translocase subunit Tim23
8	9606.ENSP00000368523	0.974	DnaJ homolog subfamily C member 15
9	9606.ENSP00000379999	0.972	Translocase of inner mitochondrial membrane 17B
10	9606.ENSP00000169551	0.965	Mitochondrial import inner membrane translocase subunit Tim21
11	9606.ENSP00000249269	0.963	Mitochondrial-processing peptidase subunit beta
12	9606.ENSP00000363211	0.952	Translocase of inner mitochondrial membrane 23 homolog B
13	9606.ENSP00000360782	0.947	Mitochondrial-processing peptidase subunit alpha
14	9606.ENSP00000257245	0.909	Mitochondrial import inner membrane translocase subunit Tim10
15	9606.ENSP00000329558	0.905	GrpE protein homolog 2, mitochondrial
16	9606.ENSP00000215570	0.867	Mitochondrial import inner membrane translocase subunit Tim13
17	9606.ENSP00000361993	0.861	Mitochondrial import inner membrane translocase subunit Tim8 A
18	9606.ENSP00000216034	0.857	Mitochondrial import receptor subunit TOM22 homolog
19	9606.ENSP00000363191	0.833	Reactive oxygen species modulator 1
20	9606.ENSP00000378588	0.821	Mitochondrial import inner membrane translocase subunit Tim9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010941	0.956	regulation of cell death
GO:0009987	0.926	cellular process
GO:2001233	0.911	regulation of apoptotic signaling pathway
GO:2001234	0.901	negative regulation of apoptotic signaling pathway
GO:0071840	0.882	cellular component organization or biogenesis
GO:0016043	0.863	cellular component organization
GO:0019222	0.798	regulation of metabolic process
GO:0006996	0.784	organelle organization
GO:0009894	0.739	regulation of catabolic process
GO:0008152	0.732	metabolic process
GO:0033365	0.687	protein localization to organelle
GO:0031323	0.651	regulation of cellular metabolic process
GO:0007005	0.635	mitochondrion organization
GO:0072594	0.610	establishment of protein localization to organelle
GO:0070585	0.600	protein localization to mitochondrion
GO:0010821	0.599	regulation of mitochondrion organization
GO:0060255	0.594	regulation of macromolecule metabolic process
GO:0051171	0.591	regulation of nitrogen compound metabolic process
GO:0080090	0.589	regulation of primary metabolic process
GO:0006886	0.580	intracellular protein transport
GO:0044237	0.575	cellular metabolic process
GO:0006605	0.560	protein targeting
GO:0071704	0.553	organic substance metabolic process
GO:0044238	0.537	primary metabolic process
GO:0090199	0.521	regulation of release of cytochrome c from mitochondria
GO:0010823	0.515	negative regulation of mitochondrion organization
GO:0009895	0.476	negative regulation of catabolic process
GO:0031330	0.473	negative regulation of cellular catabolic process
GO:0051053	0.472	negative regulation of DNA metabolic process
GO:0006807	0.460	nitrogen compound metabolic process
GO:0006839	0.444	mitochondrial transport
GO:0072655	0.440	establishment of protein localization to mitochondrion
GO:0006626	0.426	protein targeting to mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005744	0.999	TIM23 mitochondrial import inner membrane translocase complex
GO:0005759	0.997	mitochondrial matrix
GO:0005654	0.336	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]