StarFunc result for job id Q9Y3E1

User Input

>input (203 residues)
MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPK
DLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTADA
SSEEEGDRVEEDGKGKRKNEKAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSS
EGGDAGNDTRNTTSDLQKTSEGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R216	0.470	0.470	6.232E-30	203	1.000	1.000	A0A024R216.pdb.gz
2	AFDB:Q5FVD1	0.454	0.459	1.066E-23	201	0.754	0.761	Q5FVD1.pdb.gz	Q5FVD1_DANRE Hepatoma-derived growth factor-related protein 3 OS=Danio rerio OX=7955 GN=zgc:92612 PE=1 SV=1
3	AFDB:A0A384NPW1	0.449	0.381	1.414E-17	240	0.557	0.471	A0A384NPW1.pdb.gz	A0A384NPW1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:Q7Z4V5	0.443	0.136	2.350E-17	671	0.483	0.146	Q7Z4V5.pdb.gz	HDGR2_HUMAN Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1
5	AFDB:P51859	0.447	0.385	5.035E-17	237	0.547	0.468	P51859.pdb.gz	HDGF_MOUSE Hepatoma-derived growth factor OS=Mus musculus OX=10090 GN=Hdgf PE=1 SV=2
6	AFDB:Q5XXA9	0.444	0.157	8.368E-17	579	0.463	0.162	Q5XXA9.pdb.gz	PSIP1_CHICK Lens epithelium-derived growth factor OS=Gallus gallus OX=9031 GN=PSIP1 PE=2 SV=1
7	AFDB:Q3UMU9	0.443	0.137	1.079E-16	669	0.463	0.141	Q3UMU9.pdb.gz	HDGR2_MOUSE Hepatoma-derived growth factor-related protein 2 OS=Mus musculus OX=10090 GN=Hdgfl2 PE=1 SV=1
8	AFDB:O75475	0.443	0.171	7.250E-16	530	0.433	0.166	O75475.pdb.gz	PSIP1_HUMAN PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1
9	PDB:6s01K	0.380	0.845	1.800E-10	86	0.330	0.779	6s01K.pdb.gz	Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.
10	AFDB:Q49A26	0.377	0.153	2.967E-8	553	0.286	0.105	Q49A26.pdb.gz	GLYR1_HUMAN Cytokine-like nuclear factor N-PAC OS=Homo sapiens OX=9606 GN=GLYR1 PE=1 SV=4
11	AFDB:Q9LEY4	0.354	0.058	7.692E-8	1445	0.276	0.039	Q9LEY4.pdb.gz	HUAL1_ARATH Protein HUA2-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=HULK1 PE=2 SV=1
12	PDB:7e29A	0.284	0.125	3.439E-3	496	0.103	0.042	7e29A.pdb.gz	H3K36 methylation and DNA-binding both promote Ioc4 recruitment and Isw1b remodeler function.
13	PDB:4v8mBU	0.208	0.260	8.231E-2	158	0.084	0.108	4v8mBU.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
14	PDB:5ikjA	0.215	0.103	8.231E-2	448	0.059	0.027	5ikjA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
15	PDB:7f5sLT	0.213	0.266	8.770E-2	159	0.108	0.138	7f5sLT.pdb.gz	METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.
16	PDB:7okyZ	0.225	0.126	9.345E-2	374	0.059	0.032	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
17	PDB:4pa0A	0.199	0.045	9.958E-2	974	0.039	0.008	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
18	PDB:4v8mBa	0.159	0.237	1.061E-1	132	0.059	0.091	4v8mBa.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
19	PDB:5aj0AM	0.222	0.308	1.131E-1	139	0.064	0.094	5aj0AM.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
20	PDB:4zn3A	0.254	0.343	1.284E-1	147	0.025	0.034	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y3E1	5.46e-148	410	203	1.000	1.000	HDGR3_HUMAN Hepatoma-derived growth factor-related protein 3 OS=Homo sapiens OX=9606 GN=HDGFL3 PE=1 SV=1
2	Q9JMG7	5.20e-142	395	202	0.970	0.975	HDGR3_MOUSE Hepatoma-derived growth factor-related protein 3 OS=Mus musculus OX=10090 GN=Hdgfl3 PE=1 SV=2
3	Q5FVD1	5.91e-93	271	201	0.754	0.761	Q5FVD1_DANRE Hepatoma-derived growth factor-related protein 3 OS=Danio rerio OX=7955 GN=zgc:92612 PE=1 SV=1
4	H3BPM9	1.47e-86	253	141	0.645	0.929	H3BPM9_HUMAN HDGF like 3 (Fragment) OS=Homo sapiens OX=9606 GN=HDGFL3 PE=1 SV=1
5	P51859	9.94e-62	194	237	0.512	0.439	HDGF_MOUSE Hepatoma-derived growth factor OS=Mus musculus OX=10090 GN=Hdgf PE=1 SV=2
6	Q8VHK7	5.82e-60	189	237	0.507	0.435	HDGF_RAT Hepatoma-derived growth factor OS=Rattus norvegicus OX=10116 GN=Hdgf PE=1 SV=2
7	A0A384NPW1	2.65e-59	187	240	0.483	0.408	A0A384NPW1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
8	P51858	2.65e-59	187	240	0.483	0.408	HDGF_HUMAN Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1
9	O75475	1.28e-56	189	530	0.404	0.155	PSIP1_HUMAN PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1
10	Q812D1	2.85e-56	187	528	0.399	0.153	PSIP1_RAT PC4 and SFRS1-interacting protein OS=Rattus norvegicus OX=10116 GN=Psip1 PE=1 SV=1
11	Q99JF8	6.84e-56	187	528	0.404	0.155	PSIP1_MOUSE PC4 and SFRS1-interacting protein OS=Mus musculus OX=10090 GN=Psip1 PE=1 SV=1
12	Q7Z4V5	4.77e-54	184	671	0.478	0.145	HDGR2_HUMAN Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1
13	Q925G1	1.51e-53	183	669	0.458	0.139	HDGR2_RAT Hepatoma-derived growth factor-related protein 2 OS=Rattus norvegicus OX=10116 GN=Hdgfl2 PE=1 SV=2
14	Q5XXA9	4.27e-53	180	579	0.365	0.128	PSIP1_CHICK Lens epithelium-derived growth factor OS=Gallus gallus OX=9031 GN=PSIP1 PE=2 SV=1
15	Q3UMU9	1.24e-52	180	669	0.443	0.135	HDGR2_MOUSE Hepatoma-derived growth factor-related protein 2 OS=Mus musculus OX=10090 GN=Hdgfl2 PE=1 SV=1
16	F4IN78	1.50e-09	59.3	1366	0.128	0.019	HUAL2_ARATH Protein HUA2-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=HULK2 PE=2 SV=2
17	F4IZM8	7.45e-09	57.0	1347	0.128	0.019	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
18	Q9XER9	9.37e-09	56.6	1392	0.123	0.018	HUA2_ARATH ENHANCER OF AG-4 protein 2 OS=Arabidopsis thaliana OX=3702 GN=HUA2 PE=2 SV=1
19	Q922P9	2.30e-08	55.5	546	0.286	0.106	GLYR1_MOUSE Cytokine-like nuclear factor N-PAC OS=Mus musculus OX=10090 GN=Glyr1 PE=1 SV=1
20	Q9LEY4	4.22e-08	54.7	1445	0.153	0.021	HUAL1_ARATH Protein HUA2-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=HULK1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00855 PWWP	2.7e-10	51.9	PWWP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000013185

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016601	0.727	Thyroid hormone receptor interactor 12
2	61853.ENSNLEP00000009404	0.547	SRR1 domain containing
3	61853.ENSNLEP00000022347	0.547	Stannin
4	61853.ENSNLEP00000012137	0.522	Death inducer-obliterator 1
5	61853.ENSNLEP00000002048	0.516	Bromodomain PHD finger transcription factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008017	0.991	microtubule binding
GO:0003676	0.922	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0032501	0.990	multicellular organismal process
GO:0009987	0.989	cellular process
GO:0048519	0.937	negative regulation of biological process
GO:0048856	0.917	anatomical structure development
GO:0007275	0.868	multicellular organism development
GO:0048523	0.858	negative regulation of cellular process
GO:1901879	0.795	regulation of protein depolymerization
GO:0071840	0.774	cellular component organization or biogenesis
GO:0048731	0.735	system development
GO:0032886	0.676	regulation of microtubule-based process
GO:0051129	0.600	negative regulation of cellular component organization
GO:0043242	0.594	negative regulation of protein-containing complex disassembly
GO:0070507	0.505	regulation of microtubule cytoskeleton organization
GO:0016043	0.441	cellular component organization
GO:1901880	0.420	negative regulation of protein depolymerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.992	nucleoplasm
GO:0005737	0.963	cytoplasm
GO:0005829	0.868	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]