StarFunc result for job id Q9Y3E5

User Input

>input (179 residues)
MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILG
DSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKA
PDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3KQ48	0.688	0.684	2.116E-33	180	1.000	0.994	J3KQ48.pdb.gz	J3KQ48_HUMAN aminoacyl-tRNA hydrolase OS=Homo sapiens OX=9606 GN=PTRH2 PE=1 SV=1
2	AFDB:Q5XI86	0.873	0.865	1.802E-30	181	0.804	0.796	Q5XI86.pdb.gz	Q5XI86_RAT aminoacyl-tRNA hydrolase OS=Rattus norvegicus OX=10116 GN=Ptrh2 PE=1 SV=1
3	AFDB:O13830	0.648	0.566	6.320E-18	205	0.430	0.376	O13830.pdb.gz	PTH2_SCHPO Probable peptidyl-tRNA hydrolase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC19A8.14 PE=1 SV=1
4	AFDB:P34222	0.643	0.554	9.996E-18	208	0.430	0.370	P34222.pdb.gz	PTH2_YEAST Peptidyl-tRNA hydrolase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PTH2 PE=1 SV=2
5	AFDB:F4JV77	0.672	0.624	7.539E-16	193	0.369	0.342	F4JV77.pdb.gz	F4JV77_ARATH aminoacyl-tRNA hydrolase OS=Arabidopsis thaliana OX=3702 GN=At4g32900 PE=1 SV=1
6	AFDB:Q582G7	0.631	0.550	6.547E-15	206	0.363	0.316	Q582G7.pdb.gz	Q582G7_TRYB2 aminoacyl-tRNA hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.510 PE=4 SV=1
7	AFDB:Q6GMV3	0.554	0.695	5.716E-8	140	0.184	0.236	Q6GMV3.pdb.gz	PTRD1_HUMAN Putative peptidyl-tRNA hydrolase PTRHD1 OS=Homo sapiens OX=9606 GN=PTRHD1 PE=1 SV=1
8	PDB:1pilA	0.165	0.227	9.681E-2	112	0.067	0.107	1pilA.pdb.gz
9	PDB:3lf0B	0.166	0.235	1.034E-1	112	0.089	0.143	3lf0B.pdb.gz	Crystal structures of the apo and ATP bound Mycobacterium tuberculosis nitrogen regulatory PII protein.
10	PDB:3lf0A	0.176	0.272	1.104E-1	99	0.078	0.141	3lf0A.pdb.gz	Crystal structures of the apo and ATP bound Mycobacterium tuberculosis nitrogen regulatory PII protein.
11	PDB:7wttq	0.200	0.159	1.746E-1	235	0.073	0.055	7wttq.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
12	PDB:1gnkA	0.185	0.289	1.864E-1	98	0.061	0.112	1gnkA.pdb.gz
13	PDB:5c4iE	0.183	0.113	2.422E-1	312	0.056	0.032	5c4iE.pdb.gz	The Structure of an Oxalate Oxidoreductase Provides Insight into Microbial 2-Oxoacid Metabolism.
14	PDB:1nvmB	0.169	0.112	2.761E-1	312	0.089	0.051	1nvmB.pdb.gz	Crystal structure of a bifunctional aldolase-dehydrogenase: Sequestering a reactive and volatile intermediate
15	PDB:7ax1A	0.220	0.093	3.361E-1	518	0.089	0.031	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
16	PDB:6kmsC	0.162	0.144	3.588E-1	210	0.045	0.038	6kmsC.pdb.gz	Structural insight into human N6amt1-Trm112 complex functioning as a protein methyltransferase.
17	PDB:1kwmA	0.213	0.109	4.090E-1	402	0.061	0.027	1kwmA.pdb.gz	Human procarboxypeptidase B: three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI).
18	AFDB:Q57U07	0.190	0.141	4.990E-1	297	0.101	0.061	Q57U07.pdb.gz	Q57U07_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.8P12.680 PE=4 SV=1
19	AFDB:A0A384MDM5	0.216	0.126	5.689E-1	362	0.056	0.028	A0A384MDM5.pdb.gz	A0A384MDM5_HUMAN Tyrosyl-DNA phosphodiesterase 2 OS=Homo sapiens OX=9606 PE=2 SV=1
20	AFDB:Q68CQ7	0.160	0.104	6.074E-1	371	0.112	0.054	Q68CQ7.pdb.gz	GL8D1_HUMAN Glycosyltransferase 8 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GLT8D1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KQ48	1.57e-131	367	180	1.000	0.994	J3KQ48_HUMAN aminoacyl-tRNA hydrolase OS=Homo sapiens OX=9606 GN=PTRH2 PE=1 SV=1
2	Q9Y3E5	1.87e-131	367	179	1.000	1.000	PTH2_HUMAN Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PTRH2 PE=1 SV=1
3	Q5XI86	3.14e-103	296	181	0.804	0.796	Q5XI86_RAT aminoacyl-tRNA hydrolase OS=Rattus norvegicus OX=10116 GN=Ptrh2 PE=1 SV=1
4	Q8R2Y8	2.72e-102	293	181	0.799	0.790	PTH2_MOUSE Peptidyl-tRNA hydrolase 2, mitochondrial OS=Mus musculus OX=10090 GN=Ptrh2 PE=1 SV=1
5	F4JV77	1.12e-37	130	193	0.369	0.342	F4JV77_ARATH aminoacyl-tRNA hydrolase OS=Arabidopsis thaliana OX=3702 GN=At4g32900 PE=1 SV=1
6	P34222	4.68e-36	126	208	0.346	0.298	PTH2_YEAST Peptidyl-tRNA hydrolase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PTH2 PE=1 SV=2
7	O13830	3.67e-33	119	205	0.408	0.356	PTH2_SCHPO Probable peptidyl-tRNA hydrolase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC19A8.14 PE=1 SV=1
8	Q582G7	2.48e-20	85.9	206	0.318	0.277	Q582G7_TRYB2 aminoacyl-tRNA hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.510 PE=4 SV=1
9	Q86W26	0.89	32.3	655	0.179	0.049	NAL10_HUMAN NACHT, LRR and PYD domains-containing protein 10 OS=Homo sapiens OX=9606 GN=NLRP10 PE=1 SV=1
10	Q8II36	2.1	30.8	258	0.067	0.047	Q8II36_PLAF7 Aquaglyceroporin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1132800 PE=3 SV=1
11	Q8WPZ6	2.1	30.8	258	0.067	0.047	Q8WPZ6_PLAFA Aquaglyceroporin OS=Plasmodium falciparum OX=5833 GN=AQP PE=1 SV=1
12	P43403	5.9	30.0	619	0.078	0.023	ZAP70_HUMAN Tyrosine-protein kinase ZAP-70 OS=Homo sapiens OX=9606 GN=ZAP70 PE=1 SV=1
13	P43404	7.0	29.6	618	0.078	0.023	ZAP70_MOUSE Tyrosine-protein kinase ZAP-70 OS=Mus musculus OX=10090 GN=Zap70 PE=1 SV=3
14	P78559	8.1	29.6	2803	0.151	0.010	MAP1A_HUMAN Microtubule-associated protein 1A OS=Homo sapiens OX=9606 GN=MAP1A PE=1 SV=6

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01981 PTH2	2.1e-44	162.0	Peptidyl-tRNA hydrolase PTH2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000016080

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000017421	0.750	Amino-terminal enhancer of split
2	9598.ENSPTRP00000026165	0.674	Translocase of outer mitochondrial membrane 70 homolog A
3	9598.ENSPTRP00000051461	0.668	SAFB-like, transcription modulator
4	9598.ENSPTRP00000003595	0.661	Translocase of outer mitochondrial membrane 20 homolog
5	9598.ENSPTRP00000000497	0.659	Mitochondrial E3 ubiquitin protein ligase 1
6	9598.ENSPTRP00000045565	0.659	Aspartyl-tRNA synthetase 2, mitochondrial
7	9598.ENSPTRP00000053176	0.659	Uncharacterized protein
8	9598.ENSPTRP00000061079	0.659	Voltage-dependent anion channel 2
9	9598.ENSPTRP00000052990	0.650	Mitochondrial Rho GTPase
10	9598.ENSPTRP00000018274	0.648	Peptidylprolyl isomerase
11	9598.ENSPTRP00000020548	0.629	T-complex protein 1 subunit delta
12	9598.ENSPTRP00000023245	0.584	Pan troglodytes translocase of outer mitochondrial membrane 34 (TOMM34), nuclear gene encoding mitochondrial protein, mRNA
13	9598.ENSPTRP00000009188	0.580	Ubiquitin specific peptidase 30
14	9598.ENSPTRP00000002441	0.560	Ubiquilin 4
15	9598.ENSPTRP00000041796	0.560	Uncharacterized protein
16	9598.ENSPTRP00000048917	0.552	Peptidyl-tRNA hydrolase 1 homolog
17	9598.ENSPTRP00000032761	0.535	Belongs to the HUS1 family.
18	9598.ENSPTRP00000012651	0.513	Signal peptidase complex catalytic subunit SEC11
19	9598.ENSPTRP00000017087	0.513	Signal peptidase I
20	9598.ENSPTRP00000016096	0.501	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016787	0.997	hydrolase activity
GO:0140098	0.992	catalytic activity, acting on RNA
GO:0016788	0.991	hydrolase activity, acting on ester bonds
GO:0140101	0.885	catalytic activity, acting on a tRNA
GO:0052689	0.844	carboxylic ester hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0048522	0.979	positive regulation of cellular process
GO:0010941	0.967	regulation of cell death
GO:0042981	0.957	regulation of apoptotic process
GO:0010468	0.955	regulation of gene expression
GO:0048519	0.945	negative regulation of biological process
GO:0060548	0.927	negative regulation of cell death
GO:0010942	0.925	positive regulation of cell death
GO:0043069	0.907	negative regulation of programmed cell death
GO:0043068	0.893	positive regulation of programmed cell death
GO:0010629	0.858	negative regulation of gene expression
GO:0043065	0.841	positive regulation of apoptotic process
GO:0009987	0.711	cellular process
GO:0043066	0.701	negative regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005829	0.957	cytosol
GO:0016020	0.936	membrane
GO:0032991	0.522	protein-containing complex
GO:0070013	0.451	intracellular organelle lumen
GO:0005634	0.387	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.997	Hydrolases.
EC:3.1.-.-	0.991	Acting on ester bonds.
EC:3.1.1.-	0.844	Carboxylic ester hydrolases.

[back to server]