StarFunc result for job id Q9Y3E7

User Input

>input (222 residues)
MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVC
IVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKI
PEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKA
PSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CGS4	0.878	0.874	3.552E-27	223	0.968	0.964	Q8CGS4.pdb.gz	CHMP3_RAT Charged multivesicular body protein 3 OS=Rattus norvegicus OX=10116 GN=Chmp3 PE=1 SV=3
2	PDB:3frtB	0.624	0.968	1.989E-13	142	0.635	0.993	3frtB.pdb.gz
3	AFDB:Q383S9	0.730	0.740	2.157E-13	219	0.378	0.384	Q383S9.pdb.gz	Q383S9_TRYB2 Class-E vacuolar protein-sorting protein 24 (Vps24p), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1760 PE=4 SV=1
4	AFDB:Q9FFB3	0.722	0.701	1.802E-12	229	0.405	0.393	Q9FFB3.pdb.gz	VP241_ARATH Vacuolar protein sorting-associated protein 24 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=VPS24-1 PE=1 SV=1
5	AFDB:O14296	0.678	0.652	1.343E-9	231	0.324	0.312	O14296.pdb.gz	VPS24_SCHPO Vacuolar protein sorting-associated protein 24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps24 PE=3 SV=1
6	AFDB:Q2U5N0	0.649	0.633	1.806E-9	228	0.329	0.320	Q2U5N0.pdb.gz	Q2U5N0_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090113000079 PE=4 SV=1
7	AFDB:Q5AXR0	0.661	0.645	3.605E-9	228	0.338	0.329	Q5AXR0.pdb.gz	Q5AXR0_EMENI SNF7 family protein (AFU_orthologue AFUA_5G13890) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06920 PE=4 SV=1
8	AFDB:P36095	0.658	0.652	2.514E-7	224	0.284	0.281	P36095.pdb.gz	VPS24_YEAST Vacuolar protein-sorting-associated protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS24 PE=1 SV=1
9	AFDB:Q386U8	0.490	0.507	1.464E-4	214	0.275	0.285	Q386U8.pdb.gz	Q386U8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.18.0015 PE=4 SV=1
10	AFDB:A0A087WW88	0.460	0.447	2.283E-4	229	0.270	0.262	A0A087WW88.pdb.gz	A0A087WW88_HUMAN Charged multivesicular body protein 2B OS=Homo sapiens OX=9606 GN=CHMP2B PE=1 SV=2
11	AFDB:O43633	0.477	0.477	2.283E-4	222	0.275	0.275	O43633.pdb.gz	CHM2A_HUMAN Charged multivesicular body protein 2a OS=Homo sapiens OX=9606 GN=CHMP2A PE=1 SV=1
12	PDB:6xz6A	0.185	0.193	4.211E-1	213	0.131	0.136	6xz6A.pdb.gz
13	PDB:6tz402	0.321	0.396	1.076	176	0.095	0.119	6tz402.pdb.gz
14	PDB:4h63H	0.160	0.199	1.130	174	0.113	0.144	4h63H.pdb.gz
15	PDB:6q0xA	0.175	0.121	1.377	373	0.090	0.054	6q0xA.pdb.gz
16	PDB:3u8vA	0.181	0.463	1.447	83	0.059	0.157	3u8vA.pdb.gz
17	PDB:6n63A	0.303	0.445	1.447	141	0.054	0.085	6n63A.pdb.gz	Large protein organelles form a new iron sequestration system with high storage capacity.
18	PDB:4kxrB	0.230	0.272	1.762	174	0.086	0.109	4kxrB.pdb.gz
19	PDB:7c1iA	0.163	0.310	2.370	115	0.050	0.096	7c1iA.pdb.gz
20	PDB:1x8zA	0.185	0.268	2.616	151	0.036	0.053	1x8zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y3E7	1.18e-158	439	222	1.000	1.000	CHMP3_HUMAN Charged multivesicular body protein 3 OS=Homo sapiens OX=9606 GN=CHMP3 PE=1 SV=3
2	Q8CGS4	1.32e-151	421	223	0.968	0.964	CHMP3_RAT Charged multivesicular body protein 3 OS=Rattus norvegicus OX=10116 GN=Chmp3 PE=1 SV=3
3	Q9FFB3	1.62e-40	140	229	0.414	0.402	VP241_ARATH Vacuolar protein sorting-associated protein 24 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=VPS24-1 PE=1 SV=1
4	Q383S9	2.94e-35	126	219	0.302	0.306	Q383S9_TRYB2 Class-E vacuolar protein-sorting protein 24 (Vps24p), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1760 PE=4 SV=1
5	Q5AXR0	1.04e-29	112	228	0.338	0.329	Q5AXR0_EMENI SNF7 family protein (AFU_orthologue AFUA_5G13890) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06920 PE=4 SV=1
6	Q2U5N0	1.87e-28	108	228	0.333	0.325	Q2U5N0_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090113000079 PE=4 SV=1
7	O14296	2.66e-27	105	231	0.306	0.294	VPS24_SCHPO Vacuolar protein sorting-associated protein 24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps24 PE=3 SV=1
8	P36095	2.97e-22	92.4	224	0.297	0.295	VPS24_YEAST Vacuolar protein-sorting-associated protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS24 PE=1 SV=1
9	F1M8B7	1.26e-16	77.4	213	0.270	0.282	F1M8B7_RAT Charged multivesicular body protein 2B OS=Rattus norvegicus OX=10116 GN=Chmp2b PE=1 SV=2
10	B2RE76	1.36e-16	77.4	213	0.270	0.282	B2RE76_HUMAN Chromatin modifying protein 2B OS=Homo sapiens OX=9606 GN=CHMP2B PE=2 SV=1
11	Q9UQN3	1.36e-16	77.4	213	0.270	0.282	CHM2B_HUMAN Charged multivesicular body protein 2b OS=Homo sapiens OX=9606 GN=CHMP2B PE=1 SV=1
12	A0A8I5Y9Y9	3.01e-16	76.3	209	0.252	0.268	A0A8I5Y9Y9_RAT Charged multivesicular body protein 2B OS=Rattus norvegicus OX=10116 GN=Chmp2b PE=1 SV=1
13	A0A087WW88	5.53e-16	75.9	229	0.252	0.245	A0A087WW88_HUMAN Charged multivesicular body protein 2B OS=Homo sapiens OX=9606 GN=CHMP2B PE=1 SV=2
14	A0A8I6AB52	7.60e-16	75.5	229	0.252	0.245	A0A8I6AB52_RAT Charged multivesicular body protein 2B OS=Rattus norvegicus OX=10116 GN=Chmp2b PE=1 SV=1
15	A0A8I5ZYY9	1.08e-13	68.9	194	0.230	0.263	A0A8I5ZYY9_RAT Charged multivesicular body protein 2B OS=Rattus norvegicus OX=10116 GN=Chmp2b PE=1 SV=1
16	Q9U2F6	5.80e-13	67.8	237	0.203	0.190	Q9U2F6_CAEEL Charged multivesicular body protein 2a OS=Caenorhabditis elegans OX=6239 GN=vps-2 PE=1 SV=1
17	Q9DB34	7.23e-13	67.4	222	0.185	0.185	CHM2A_MOUSE Charged multivesicular body protein 2a OS=Mus musculus OX=10090 GN=Chmp2a PE=1 SV=1
18	O43633	1.15e-12	66.6	222	0.185	0.185	CHM2A_HUMAN Charged multivesicular body protein 2a OS=Homo sapiens OX=9606 GN=CHMP2A PE=1 SV=1
19	Q9SKI2	4.79e-12	65.1	225	0.270	0.267	VPS2A_ARATH Vacuolar protein sorting-associated protein 2 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=VPS2.1 PE=1 SV=2
20	C9J0A7	1.30e-10	60.5	183	0.261	0.317	C9J0A7_HUMAN Charged multivesicular body protein 2B OS=Homo sapiens OX=9606 GN=CHMP2B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12774 AAA_6	71	13.8	Hydrolytic ATP binding site of dynein motor region
2	PF13054 DUF3915	5.3e+02	12.0	Protein of unknown function (DUF3915)
3	PF03357 Snf7	1.2e-37	140.7	Snf7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003816605.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003816688.1	0.977	Charged multivesicular body protein 2A
2	9597.XP_003832047.1	0.974	Charged multivesicular body protein 4b
3	9597.XP_003830167.1	0.972	Charged multivesicular body protein 5
4	9597.XP_003831202.1	0.963	Charged multivesicular body protein 6
5	9597.XP_003831314.1	0.959	Charged multivesicular body protein 4C
6	9597.XP_003831732.2	0.956	Putative charged multivesicular body protein 4B-like protein CHMP4BP1
7	9597.XP_003827317.1	0.955	Belongs to the AAA ATPase family.
8	9597.XP_003811749.1	0.940	Charged multivesicular body protein 1b
9	9597.XP_008959501.1	0.936	Charged multivesicular body protein 4A
10	9597.XP_003810409.1	0.925	STAM binding protein
11	9597.XP_003829547.1	0.922	IST1, ESCRT-III associated factor
12	9597.XP_003814600.2	0.917	Belongs to the AAA ATPase family.
13	9597.XP_003827760.1	0.917	Vesicle trafficking 1
14	9597.XP_003831559.1	0.912	Charged multivesicular body protein 2B
15	9597.XP_003807500.1	0.903	Vacuolar protein sorting 36 homolog
16	9597.XP_003813954.1	0.892	Vacuolar protein-sorting-associated protein 25
17	9597.XP_008975465.1	0.892	Charged multivesicular body protein 7 isoform X1
18	9597.XP_008961100.1	0.887	STAM binding protein like 1
19	9597.XP_003819469.1	0.883	Component of the ESCRT-I complex (endosomal sorting complex required for transport I), a regulator of vesicular trafficking process
20	9597.XP_003826370.1	0.876	VPS37C, ESCRT-I subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043167	1.000	ion binding
GO:0005515	1.000	protein binding
GO:0005543	1.000	phospholipid binding
GO:0043168	0.982	anion binding
GO:1902936	0.897	phosphatidylinositol bisphosphate binding
GO:0005546	0.818	phosphatidylinositol-4,5-bisphosphate binding
GO:0019899	0.661	enzyme binding
GO:0042802	0.583	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0051726	0.978	regulation of cell cycle
GO:0007041	0.976	lysosomal transport
GO:0016192	0.955	vesicle-mediated transport
GO:0008333	0.951	endosome to lysosome transport
GO:0071840	0.925	cellular component organization or biogenesis
GO:0016043	0.919	cellular component organization
GO:0010564	0.919	regulation of cell cycle process
GO:0048518	0.776	positive regulation of biological process
GO:0050896	0.774	response to stimulus
GO:0048522	0.752	positive regulation of cellular process
GO:0008152	0.662	metabolic process
GO:0006996	0.639	organelle organization
GO:0044237	0.620	cellular metabolic process
GO:0009056	0.543	catabolic process
GO:0010256	0.497	endomembrane system organization
GO:0007032	0.490	endosome organization
GO:0071704	0.458	organic substance metabolic process
GO:0044238	0.448	primary metabolic process
GO:0044248	0.437	cellular catabolic process
GO:0051603	0.408	proteolysis involved in protein catabolic process
GO:0016197	0.402	endosomal transport
GO:0061024	0.399	membrane organization
GO:0044265	0.369	cellular macromolecule catabolic process
GO:0071985	0.343	multivesicular body sorting pathway
GO:0006511	0.339	ubiquitin-dependent protein catabolic process
GO:0000278	0.336	mitotic cell cycle
GO:0016236	0.329	macroautophagy
GO:0032509	0.327	endosome transport via multivesicular body sorting pathway
GO:0043162	0.321	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0033043	0.319	regulation of organelle organization
GO:0070925	0.312	organelle assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098588	0.995	bounding membrane of organelle
GO:0005768	0.995	endosome
GO:0010008	0.994	endosome membrane
GO:0005770	0.993	late endosome
GO:0036452	0.992	ESCRT complex
GO:0098796	0.990	membrane protein complex
GO:0005886	0.989	plasma membrane
GO:0005773	0.985	vacuole
GO:0005774	0.984	vacuolar membrane
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0005829	0.979	cytosol
GO:0005634	0.977	nucleus
GO:0030496	0.972	midbody
GO:0005576	0.941	extracellular region
GO:0031902	0.932	late endosome membrane
GO:0000323	0.926	lytic vacuole
GO:0005765	0.920	lysosomal membrane
GO:0000793	0.841	condensed chromosome
GO:0043230	0.838	extracellular organelle
GO:0070062	0.833	extracellular exosome
GO:0099080	0.830	supramolecular complex
GO:0015630	0.804	microtubule cytoskeleton
GO:0005771	0.764	multivesicular body
GO:0000421	0.709	autophagosome membrane
GO:0000776	0.664	kinetochore
GO:0099512	0.556	supramolecular fiber
GO:0000815	0.537	ESCRT III complex
GO:0005874	0.515	microtubule
GO:0031975	0.506	envelope
GO:0031967	0.502	organelle envelope
GO:0005635	0.401	nuclear envelope
GO:0031981	0.358	nuclear lumen
GO:0005654	0.334	nucleoplasm
GO:0140513	0.324	nuclear protein-containing complex
GO:0005819	0.311	spindle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]