StarFunc result for job id Q9Y3I0

User Input

>input (505 residues)
MSRSYNDELQFLEKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVG
GFLPAMKQIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDI
NCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSL
REGYAWAEDKEHCEEYGRMLQADPNKVSARAKKRGLPQLGTLGAGNHYAEIQVVDEIFNE
YAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIAS
PEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDLHVIYDVSHNIAKVEQ
HVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMT
ETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTD
VVNTCHDAGISKKAIKLRPIAVIKG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99LF4	0.999	0.999	0.000	505	0.994	0.994	Q99LF4.pdb.gz	RTCB_MOUSE RNA-splicing ligase RtcB homolog OS=Mus musculus OX=10090 GN=Rtcb PE=1 SV=1
2	AFDB:Q9VIW7	0.997	0.995	7.171E-99	506	0.851	0.850	Q9VIW7.pdb.gz	RTCB_DROME RNA-splicing ligase RtcB homolog OS=Drosophila melanogaster OX=7227 GN=RtcB PE=2 SV=1
3	PDB:7p3bB	0.975	0.991	7.979E-94	497	0.984	1.000	7p3bB.pdb.gz	Molecular architecture of the human tRNA ligase complex.
4	AFDB:Q54Y09	0.991	0.985	1.776E-92	508	0.745	0.740	Q54Y09.pdb.gz	RTCB_DICDI RNA-splicing ligase RtcB homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0278481 PE=3 SV=1
5	AFDB:P90838	0.998	0.998	2.028E-91	505	0.731	0.731	P90838.pdb.gz	RTCB_CAEEL RNA-splicing ligase RtcB homolog OS=Caenorhabditis elegans OX=6239 GN=rtcb-1 PE=1 SV=2
6	AFDB:Q8ZY09	0.934	0.974	4.246E-65	484	0.467	0.488	Q8ZY09.pdb.gz	RTCB_PYRAE tRNA-splicing ligase RtcB OS=Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2) OX=178306 GN=rtcB PE=1 SV=1
7	AFDB:P9WGW5	0.839	0.979	1.255E-55	432	0.416	0.486	P9WGW5.pdb.gz	RTCB_MYCTU RNA-splicing ligase RtcB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rtcB PE=2 SV=1
8	AFDB:O59245	0.920	0.537	5.004E-50	871	0.477	0.277	O59245.pdb.gz	RTCB_PYRHO tRNA-splicing ligase RtcB OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=rtcB PE=1 SV=1
9	AFDB:Q8TUS2	0.738	0.381	5.170E-46	988	0.358	0.183	Q8TUS2.pdb.gz	RTCB_METKA tRNA-splicing ligase RtcB OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) OX=190192 GN=rtcB PE=1 SV=1
10	AFDB:P46850	0.642	0.786	1.763E-27	408	0.234	0.289	P46850.pdb.gz	RTCB_ECOLI RNA-splicing ligase RtcB OS=Escherichia coli (strain K12) OX=83333 GN=rtcB PE=1 SV=3
11	AFDB:Q9HT99	0.603	0.788	2.081E-27	379	0.228	0.303	Q9HT99.pdb.gz	Q9HT99_PSEAE 3'-phosphate/5'-hydroxy nucleic acid ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA5471 PE=3 SV=1
12	PDB:2b51A	0.071	0.078	4.342E-1	444	0.071	0.081	2b51A.pdb.gz	Structural basis for UTP specificity of RNA editing TUTases from Trypanosoma brucei.
13	PDB:2gv1A	0.045	0.181	7.552E-1	92	0.026	0.141	2gv1A.pdb.gz
14	PDB:5wuaE	0.076	0.035	9.960E-1	1312	0.036	0.014	5wuaE.pdb.gz
15	PDB:6xovA	0.133	0.083	1.243	966	0.095	0.050	6xovA.pdb.gz	Structural basis for the mechanisms of human presequence protease conformational switch and substrate recognition.
16	PDB:3s5mA	0.061	0.032	1.639	1094	0.030	0.014	3s5mA.pdb.gz	Crystal structures of falcilysin, a M16 metalloprotease from the malaria parasite Plasmodium falciparum
17	PDB:7z1lA	0.087	0.042	1.639	1436	0.063	0.022	7z1lA.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
18	PDB:5gxuA	0.044	0.042	1.732	552	0.040	0.036	5gxuA.pdb.gz	Structure of the Arabidopsis thaliana NADPH-cytochrome P450 reductase 2 (ATR2) provides insight into its function
19	PDB:3spaA	0.083	0.057	1.831	941	0.079	0.043	3spaA.pdb.gz	Structure of human mitochondrial RNA polymerase
20	PDB:4b2tD	0.073	0.076	2.162	481	0.044	0.046	4b2tD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P90838	0.0	799	505	0.731	0.731	RTCB_CAEEL RNA-splicing ligase RtcB homolog OS=Caenorhabditis elegans OX=6239 GN=rtcb-1 PE=1 SV=2
2	Q54Y09	0.0	811	508	0.745	0.740	RTCB_DICDI RNA-splicing ligase RtcB homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0278481 PE=3 SV=1
3	Q99LF4	0.0	1046	505	0.994	0.994	RTCB_MOUSE RNA-splicing ligase RtcB homolog OS=Mus musculus OX=10090 GN=Rtcb PE=1 SV=1
4	Q9VIW7	0.0	895	506	0.851	0.850	RTCB_DROME RNA-splicing ligase RtcB homolog OS=Drosophila melanogaster OX=7227 GN=RtcB PE=2 SV=1
5	Q9Y3I0	0.0	1052	505	1.000	1.000	RTCB_HUMAN RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1
6	Q8ZY09	3.28e-157	457	484	0.467	0.488	RTCB_PYRAE tRNA-splicing ligase RtcB OS=Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2) OX=178306 GN=rtcB PE=1 SV=1
7	P9WGW5	9.69e-128	380	432	0.422	0.493	RTCB_MYCTU RNA-splicing ligase RtcB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rtcB PE=2 SV=1
8	O59245	4.12e-126	390	871	0.390	0.226	RTCB_PYRHO tRNA-splicing ligase RtcB OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=rtcB PE=1 SV=1
9	Q8TUS2	2.99e-105	338	988	0.366	0.187	RTCB_METKA tRNA-splicing ligase RtcB OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) OX=190192 GN=rtcB PE=1 SV=1
10	P46850	2.26e-36	141	408	0.255	0.316	RTCB_ECOLI RNA-splicing ligase RtcB OS=Escherichia coli (strain K12) OX=83333 GN=rtcB PE=1 SV=3
11	Q9HT99	1.73e-26	112	379	0.244	0.325	Q9HT99_PSEAE 3'-phosphate/5'-hydroxy nucleic acid ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA5471 PE=3 SV=1
12	Q389M0	5.56e-24	107	486	0.240	0.249	Q389M0_TRYB2 3'-phosphate/5'-hydroxy nucleic acid ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0830 PE=3 SV=1
13	Q5XVJ4	0.069	38.5	891	0.057	0.033	FAN1_ARATH Fanconi-associated nuclease 1 homolog OS=Arabidopsis thaliana OX=3702 GN=FAN1 PE=2 SV=2
14	Q5ZJ34	1.0	34.7	972	0.032	0.016	Q5ZJ34_CHICK TIR domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_21a21 PE=2 SV=1
15	P40467	1.6	33.9	964	0.048	0.025	ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ASG1 PE=1 SV=1
16	A1YBN2	1.7	33.9	790	0.055	0.035	A1YBN2_AERVE Conjugal transfer protein OS=Aeromonas veronii OX=654 GN=traE PE=3 SV=1
17	Q385L7	3.0	32.3	235	0.051	0.111	Q385L7_TRYB2 Dynein arm light chain, axonemal, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3200 PE=4 SV=1
18	Q80UG2	3.8	32.7	1893	0.046	0.012	PLXA4_MOUSE Plexin-A4 OS=Mus musculus OX=10090 GN=Plxna4 PE=1 SV=3
19	Q9HCM2	4.2	32.7	1894	0.046	0.012	PLXA4_HUMAN Plexin-A4 OS=Homo sapiens OX=9606 GN=PLXNA4 PE=1 SV=4
20	Q10408	5.6	32.3	1004	0.030	0.015	YD83_SCHPO Uncharacterized protein C1F3.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F3.03 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02578 Cu-oxidase_4	2.5e+02	12.6	Multi-copper polyphenol oxidoreductase laccase
2	PF01139 RtcB	5.9e-144	491.9	tRNA-splicing ligase RtcB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000006103

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017623	0.999	DEAD (Asp-Glu-Ala-Asp) box helicase 1
2	61853.ENSNLEP00000012890	0.994	Chromosome 2 open reading frame 49
3	61853.ENSNLEP00000015086	0.994	Chromosome 14 open reading frame 166
4	61853.ENSNLEP00000013855	0.992	Family with sequence similarity 98, member B
5	61853.ENSNLEP00000003389	0.987	Zinc finger and BTB domain containing 8 opposite strand
6	61853.ENSNLEP00000019438	0.967	Family with sequence similarity 98, member A
7	61853.ENSNLEP00000001251	0.914	Uncharacterized protein
8	61853.ENSNLEP00000007672	0.907	tRNA-splicing endonuclease subunit Sen34
9	61853.ENSNLEP00000005688	0.906	tRNA-splicing endonuclease subunit Sen2
10	61853.ENSNLEP00000002530	0.879	Uncharacterized protein
11	61853.ENSNLEP00000021898	0.879	annotation not available
12	61853.ENSNLEP00000020481	0.864	Family with sequence similarity 98, member C
13	61853.ENSNLEP00000014378	0.784	RNA 3'-terminal phosphate cyclase
14	61853.ENSNLEP00000011258	0.691	Ankyrin repeat and zinc finger domain containing 1
15	61853.ENSNLEP00000017139	0.651	glutamyl-prolyl-tRNA synthetase
16	61853.ENSNLEP00000019264	0.607	Transcription factor 25 (basic helix-loop-helix)
17	61853.ENSNLEP00000003056	0.559	X-box binding protein 1
18	61853.ENSNLEP00000010840	0.545	RNA terminal phosphate cyclase-like 1
19	61853.ENSNLEP00000005856	0.538	tRNA phosphotransferase 1
20	61853.ENSNLEP00000009140	0.519	Cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion).

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003972	1.000	RNA ligase (ATP) activity
GO:0005515	0.998	protein binding
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.996	organic cyclic compound binding
GO:0003723	0.994	RNA binding
GO:0017166	0.992	vinculin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0043170	0.983	macromolecule metabolic process
GO:0034641	0.981	cellular nitrogen compound metabolic process
GO:0010467	0.967	gene expression
GO:0090304	0.959	nucleic acid metabolic process
GO:0006396	0.936	RNA processing
GO:0008380	0.926	RNA splicing
GO:0034660	0.841	ncRNA metabolic process
GO:0006399	0.827	tRNA metabolic process
GO:0008033	0.799	tRNA processing
GO:0050789	0.742	regulation of biological process
GO:0032502	0.643	developmental process
GO:0050794	0.585	regulation of cellular process
GO:0048856	0.491	anatomical structure development
GO:0019222	0.473	regulation of metabolic process
GO:0060255	0.425	regulation of macromolecule metabolic process
GO:0001890	0.406	placenta development
GO:0032501	0.345	multicellular organismal process
GO:0048518	0.342	positive regulation of biological process
GO:0010468	0.322	regulation of gene expression
GO:0051171	0.316	regulation of nitrogen compound metabolic process
GO:0080090	0.313	regulation of primary metabolic process
GO:0031323	0.307	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005654	0.969	nucleoplasm
GO:0032991	0.955	protein-containing complex
GO:0005829	0.940	cytosol
GO:0016020	0.800	membrane
GO:1902494	0.727	catalytic complex
GO:0140535	0.463	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.5.1.3	1.000	RNA ligase (ATP).

[back to server]