StarFunc result for job id Q9Y3I1

User Input

>input (522 residues)
MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDE
ETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQP
SDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVP
HSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMH
PLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKD
LQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCR
DLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTH
TIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRP
RFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y3I1	0.999	0.999	5.384E-89	522	1.000	1.000	Q9Y3I1.pdb.gz	FBX7_HUMAN F-box only protein 7 OS=Homo sapiens OX=9606 GN=FBXO7 PE=1 SV=1
2	AFDB:Q3U7U3	0.611	0.610	4.045E-71	523	0.732	0.730	Q3U7U3.pdb.gz	FBX7_MOUSE F-box only protein 7 OS=Mus musculus OX=10090 GN=Fbxo7 PE=1 SV=2
3	AFDB:Q4V8X6	0.466	0.497	5.942E-41	486	0.383	0.412	Q4V8X6.pdb.gz	Q4V8X6_DANRE F-box only protein 7 OS=Danio rerio OX=7955 GN=si:ch211-286m4.2 PE=1 SV=1
4	AFDB:Q8GZV6	0.241	0.171	3.987E-20	776	0.192	0.129	Q8GZV6.pdb.gz	Q8GZV6_ORYSJ BHLH domain-containing protein OS=Oryza sativa subsp. japonica OX=39947 GN=OJ1017C11.10 PE=3 SV=1
5	AFDB:Q9ZUB9	0.282	0.391	1.157E-13	350	0.146	0.217	Q9ZUB9.pdb.gz	FB17_ARATH Putative F-box protein At1g23770 OS=Arabidopsis thaliana OX=3702 GN=At1g23770 PE=4 SV=1
6	AFDB:Q19257	0.166	0.258	1.809E-6	311	0.098	0.164	Q19257.pdb.gz	Q19257_CAEEL PI31_Prot_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F09E5.7 PE=1 SV=1
7	AFDB:Q9NRR5	0.151	0.133	5.881E-5	601	0.119	0.103	Q9NRR5.pdb.gz	UBQL4_HUMAN Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2
8	AFDB:A0A1D8PGE3	0.126	0.155	9.749E-5	416	0.071	0.089	A0A1D8PGE3.pdb.gz	A0A1D8PGE3_CANAL UV excision repair protein RAD23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD23 PE=3 SV=1
9	AFDB:Q7KVG9	0.075	0.070	2.022E-3	596	0.138	0.121	Q7KVG9.pdb.gz	Q7KVG9_DROME Chip, isoform B OS=Drosophila melanogaster OX=7227 GN=Chi PE=2 SV=1
10	PDB:6mdhA	0.118	0.369	3.192E-3	149	0.023	0.081	6mdhA.pdb.gz
11	AFDB:P54728	0.135	0.166	3.751E-3	416	0.065	0.082	P54728.pdb.gz	RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus OX=10090 GN=Rad23b PE=1 SV=2
12	PDB:4pyuA	0.126	0.713	4.471E-3	76	0.027	0.184	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
13	PDB:3plvA	0.125	0.693	5.920E-3	80	0.023	0.150	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
14	PDB:6yvaC	0.123	0.377	6.262E-3	155	0.031	0.103	6yvaC.pdb.gz
15	PDB:4kv3A	0.125	0.141	9.813E-3	456	0.034	0.039	4kv3A.pdb.gz	Structures of EccB1 and EccD1 from the core complex of the mycobacterial ESX-1 type VII secretion system.
16	PDB:7np7D1	0.135	0.145	9.813E-3	485	0.025	0.027	7np7D1.pdb.gz
17	PDB:7rbsB	0.127	0.389	9.813E-3	157	0.036	0.121	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
18	PDB:7r7sI	0.125	0.512	1.454E-2	113	0.019	0.088	7r7sI.pdb.gz	Structural and Functional Analysis of Disease-Linked p97 ATPase Mutant Complexes.
19	PDB:7np7D4	0.141	0.174	1.538E-2	415	0.031	0.039	7np7D4.pdb.gz
20	PDB:7vvbB	0.125	0.697	1.538E-2	77	0.023	0.156	7vvbB.pdb.gz	Structural insights into Ras regulation by SIN1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3U7U3	0.0	773	523	0.732	0.730	FBX7_MOUSE F-box only protein 7 OS=Mus musculus OX=10090 GN=Fbxo7 PE=1 SV=2
2	Q68FS3	0.0	774	522	0.726	0.726	FBX7_RAT F-box only protein 7 OS=Rattus norvegicus OX=10116 GN=Fbxo7 PE=2 SV=1
3	Q9Y3I1	0.0	1065	522	1.000	1.000	FBX7_HUMAN F-box only protein 7 OS=Homo sapiens OX=9606 GN=FBXO7 PE=1 SV=1
4	Q4V8X6	8.75e-76	249	486	0.397	0.426	Q4V8X6_DANRE F-box only protein 7 OS=Danio rerio OX=7955 GN=si:ch211-286m4.2 PE=1 SV=1
5	Q9UK97	8.40e-06	50.8	447	0.084	0.098	FBX9_HUMAN F-box only protein 9 OS=Homo sapiens OX=9606 GN=FBXO9 PE=1 SV=1
6	Q8BK06	7.07e-05	47.8	437	0.059	0.071	FBX9_MOUSE F-box only protein 9 OS=Mus musculus OX=10090 GN=Fbxo9 PE=1 SV=1
7	Q7ZTY2	1.29e-04	46.6	356	0.079	0.115	Q7ZTY2_DANRE F-box only protein 32 OS=Danio rerio OX=7955 GN=zgc:56479 PE=2 SV=1
8	Q54S82	2.07e-04	45.8	326	0.056	0.089	Q54S82_DICDI Proteasome inhibitor PI31 subunit OS=Dictyostelium discoideum OX=44689 GN=psmF1 PE=3 SV=1
9	Q8GZV6	2.14e-04	46.6	776	0.080	0.054	Q8GZV6_ORYSJ BHLH domain-containing protein OS=Oryza sativa subsp. japonica OX=39947 GN=OJ1017C11.10 PE=3 SV=1
10	Q9ZUB8	2.97e-04	45.8	475	0.205	0.225	SKI22_ARATH F-box protein SKIP22 OS=Arabidopsis thaliana OX=3702 GN=SKIP22 PE=1 SV=1
11	Q9ZUB9	0.002	42.7	350	0.117	0.174	FB17_ARATH Putative F-box protein At1g23770 OS=Arabidopsis thaliana OX=3702 GN=At1g23770 PE=4 SV=1
12	Q7TSL3	0.021	40.0	843	0.033	0.020	FBX11_RAT F-box only protein 11 OS=Rattus norvegicus OX=10116 GN=Fbxo11 PE=2 SV=1
13	Q7TPD1	0.022	40.0	930	0.033	0.018	FBX11_MOUSE F-box only protein 11 OS=Mus musculus OX=10090 GN=Fbxo11 PE=1 SV=3
14	Q86XK2	0.022	40.0	927	0.033	0.018	FBX11_HUMAN F-box only protein 11 OS=Homo sapiens OX=9606 GN=FBXO11 PE=1 SV=3
15	Q9FLX3	0.023	39.3	269	0.044	0.086	FB293_ARATH F-box protein At5g52880 OS=Arabidopsis thaliana OX=3702 GN=At5g52880 PE=2 SV=1
16	Q54DE4	0.034	39.3	530	0.036	0.036	Q54DE4_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292312 PE=4 SV=1
17	Q5A9A6	0.036	39.3	768	0.031	0.021	Q5A9A6_CANAL SCF ubiquitin ligase complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC4 PE=4 SV=1
18	Q9FHK0	0.042	38.5	316	0.061	0.101	SKI31_ARATH F-box protein SKIP31 OS=Arabidopsis thaliana OX=3702 GN=SKIP31 PE=1 SV=1
19	Q9FIQ1	0.14	37.4	732	0.059	0.042	UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana OX=3702 GN=UBP21 PE=2 SV=1
20	Q9P7W4	0.32	36.2	662	0.042	0.033	POF10_SCHPO F-box/WD repeat-containing protein pof10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00646 F-box	1.9	19.8	F-box domain
2	PF12937 F-box-like	1.1e-05	36.5	F-box-like
3	PF11566 PI31_Prot_N	0.0009	30.5	PI31 proteasome regulator N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000266087

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231487	0.997	S-phase kinase-associated protein 1
2	9606.ENSP00000326804	0.978	Cullin-1
3	9606.ENSP00000338039	0.953	Proteasome inhibitor PI31 subunit
4	9606.ENSP00000364204	0.950	Serine/threonine-protein kinase PINK1, mitochondrial
5	9606.ENSP00000355865	0.849	E3 ubiquitin-protein ligase parkin
6	9606.ENSP00000290541	0.825	Proteasome subunit beta type-4
7	9606.ENSP00000216225	0.823	E3 ubiquitin-protein ligase RBX1
8	9606.ENSP00000378812	0.815	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2
9	9606.ENSP00000327214	0.811	Cation-transporting ATPase 13A2
10	9606.ENSP00000416255	0.803	Eukaryotic translation initiation factor 4 gamma 1
11	9606.ENSP00000250495	0.779	NEDD8
12	9606.ENSP00000477613	0.777	Baculoviral IAP repeat-containing protein 2
13	9606.ENSP00000265734	0.770	Cyclin-dependent kinase 6
14	9606.ENSP00000333142	0.764	85/88 kDa calcium-independent phospholipase A2
15	9606.ENSP00000325919	0.762	Proteasome assembly chaperone 2
16	9606.ENSP00000483688	0.754	Proteasome subunit beta type-3
17	9606.ENSP00000262193	0.745	Proteasome subunit beta type-1
18	9606.ENSP00000387170	0.736	GRB10-interacting GYF protein 2
19	9606.ENSP00000247191	0.728	Disks large-associated protein 5
20	9606.ENSP00000259457	0.728	Proteasome subunit beta type-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0003824	0.996	catalytic activity
GO:0140096	0.981	catalytic activity, acting on a protein
GO:0016740	0.973	transferase activity
GO:0004842	0.930	ubiquitin-protein transferase activity
GO:0060090	0.916	molecular adaptor activity
GO:0030674	0.908	protein-macromolecule adaptor activity
GO:0031625	0.897	ubiquitin protein ligase binding
GO:1990756	0.892	ubiquitin ligase-substrate adaptor activity
GO:0043130	0.887	ubiquitin binding
GO:0046982	0.873	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0019222	0.986	regulation of metabolic process
GO:0048519	0.982	negative regulation of biological process
GO:0009893	0.981	positive regulation of metabolic process
GO:0048523	0.969	negative regulation of cellular process
GO:0031323	0.960	regulation of cellular metabolic process
GO:0071704	0.916	organic substance metabolic process
GO:0009894	0.912	regulation of catabolic process
GO:0044238	0.906	primary metabolic process
GO:0031329	0.899	regulation of cellular catabolic process
GO:0048522	0.889	positive regulation of cellular process
GO:0006807	0.887	nitrogen compound metabolic process
GO:0043170	0.868	macromolecule metabolic process
GO:0010506	0.861	regulation of autophagy
GO:0044237	0.850	cellular metabolic process
GO:0051128	0.822	regulation of cellular component organization
GO:1901564	0.791	organonitrogen compound metabolic process
GO:0031325	0.772	positive regulation of cellular metabolic process
GO:0019538	0.755	protein metabolic process
GO:0010941	0.751	regulation of cell death
GO:0033043	0.748	regulation of organelle organization
GO:0060255	0.697	regulation of macromolecule metabolic process
GO:0010821	0.693	regulation of mitochondrion organization
GO:1903146	0.651	regulation of autophagy of mitochondrion
GO:0006508	0.614	proteolysis
GO:0080090	0.607	regulation of primary metabolic process
GO:0036211	0.590	protein modification process
GO:0071840	0.576	cellular component organization or biogenesis
GO:0009056	0.576	catabolic process
GO:0006511	0.559	ubiquitin-dependent protein catabolic process
GO:0048583	0.553	regulation of response to stimulus
GO:0051171	0.532	regulation of nitrogen compound metabolic process
GO:0060548	0.510	negative regulation of cell death
GO:0016043	0.482	cellular component organization
GO:0070647	0.474	protein modification by small protein conjugation or removal
GO:0050896	0.473	response to stimulus
GO:0051246	0.430	regulation of protein metabolic process
GO:1901214	0.412	regulation of neuron death
GO:0051179	0.390	localization
GO:0080134	0.381	regulation of response to stress
GO:0009896	0.345	positive regulation of catabolic process
GO:0032446	0.333	protein modification by small protein conjugation
GO:0051716	0.325	cellular response to stimulus
GO:0010604	0.322	positive regulation of macromolecule metabolic process
GO:0051641	0.319	cellular localization
GO:0016567	0.319	protein ubiquitination
GO:0010638	0.316	positive regulation of organelle organization
GO:0065008	0.305	regulation of biological quality
GO:0031331	0.305	positive regulation of cellular catabolic process
GO:0006996	0.302	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005739	0.996	mitochondrion
GO:0005829	0.983	cytosol
GO:0070013	0.980	intracellular organelle lumen
GO:0031981	0.969	nuclear lumen
GO:0005654	0.960	nucleoplasm
GO:0032991	0.957	protein-containing complex
GO:1902494	0.816	catalytic complex
GO:0140535	0.799	intracellular protein-containing complex
GO:1990234	0.730	transferase complex
GO:0000151	0.716	ubiquitin ligase complex
GO:0031461	0.605	cullin-RING ubiquitin ligase complex
GO:0043005	0.598	neuron projection
GO:0019005	0.495	SCF ubiquitin ligase complex
GO:0097413	0.379	Lewy body
GO:0097409	0.365	glial cytoplasmic inclusion
GO:1990038	0.365	Lewy body corona
GO:1990037	0.365	Lewy body core
GO:0097462	0.365	Lewy neurite
GO:0097414	0.365	classical Lewy body
GO:0012505	0.337	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.973	Transferases.

[back to server]