StarFunc result for job id Q9Y3M2

User Input

>input (126 residues)
MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWI
AETGVSGGVDRREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELR
ISRKRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y3M2	1.000	1.000	7.285E-19	126	1.000	1.000	Q9Y3M2.pdb.gz	CBY1_HUMAN Protein chibby homolog 1 OS=Homo sapiens OX=9606 GN=CBY1 PE=1 SV=1
2	AFDB:Q9D1C2	0.760	0.755	6.095E-15	127	0.841	0.835	Q9D1C2.pdb.gz	CBY1_MOUSE Protein chibby homolog 1 OS=Mus musculus OX=10090 GN=Cby1 PE=1 SV=1
3	AFDB:B9A0M5	0.353	0.339	1.330E-4	132	0.254	0.242	B9A0M5.pdb.gz	B9A0M5_DROME Chibby, isoform E OS=Drosophila melanogaster OX=7227 GN=Cby PE=1 SV=4
4	AFDB:Q8NA61	0.387	0.118	7.259E-3	448	0.230	0.065	Q8NA61.pdb.gz	CBY2_HUMAN Protein chibby homolog 2 OS=Homo sapiens OX=9606 GN=CBY2 PE=1 SV=1
5	AFDB:Q32MG2	0.403	0.123	1.679E-2	446	0.222	0.063	Q32MG2.pdb.gz	CBY2_MOUSE Protein chibby homolog 2 OS=Mus musculus OX=10090 GN=Cby2 PE=1 SV=2
6	PDB:6jl8A	0.158	0.052	9.650E-1	453	0.063	0.018	6jl8A.pdb.gz
7	PDB:1ni5A	0.149	0.054	1.171	433	0.079	0.023	1ni5A.pdb.gz
8	AFDB:Q86TJ5	0.169	0.050	1.350	538	0.127	0.030	Q86TJ5.pdb.gz	ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens OX=9606 GN=ZNF554 PE=1 SV=1
9	AFDB:Q94AQ8	0.127	0.056	1.748	348	0.087	0.032	Q94AQ8.pdb.gz	PNSB2_ARATH Photosynthetic NDH subunit of subcomplex B 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PNSB2 PE=1 SV=1
10	PDB:7odrY	0.191	0.137	1.962	181	0.167	0.116	7odrY.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
11	PDB:3aquA	0.147	0.062	2.232	344	0.040	0.015	3aquA.pdb.gz
12	PDB:6lkfA	0.147	0.134	2.232	140	0.056	0.050	6lkfA.pdb.gz
13	PDB:3cpeA	0.169	0.040	2.381	553	0.032	0.007	3cpeA.pdb.gz
14	AFDB:B7ZR30	0.360	0.059	2.574	950	0.159	0.021	B7ZR30.pdb.gz	STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis OX=8355 GN=stk10-a PE=1 SV=1
15	PDB:1ak5A	0.151	0.064	2.709	329	0.040	0.015	1ak5A.pdb.gz
16	PDB:2p50A	0.154	0.053	2.709	382	0.048	0.016	2p50A.pdb.gz	Structural Diversity within the Mononuclear and Binuclear Active Sites of N-Acetyl-d-glucosamine-6-phosphate Deacetylase.
17	AFDB:Q6ZS27	0.202	0.085	2.745	426	0.048	0.014	Q6ZS27.pdb.gz	ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens OX=9606 GN=ZNF662 PE=1 SV=1
18	AFDB:Q00577	0.412	0.174	2.928	322	0.079	0.031	Q00577.pdb.gz	PURA_HUMAN Transcriptional activator protein Pur-alpha OS=Homo sapiens OX=9606 GN=PURA PE=1 SV=2
19	PDB:5ln3C	0.203	0.101	3.082	261	0.079	0.038	5ln3C.pdb.gz	Molecular Details Underlying Dynamic Structures and Regulation of the Human 26S Proteasome.
20	PDB:6s1kA	0.136	0.046	3.287	383	0.032	0.010	6s1kA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y3M2	1.30e-88	254	126	1.000	1.000	CBY1_HUMAN Protein chibby homolog 1 OS=Homo sapiens OX=9606 GN=CBY1 PE=1 SV=1
2	Q9D1C2	6.99e-76	222	127	0.825	0.819	CBY1_MOUSE Protein chibby homolog 1 OS=Mus musculus OX=10090 GN=Cby1 PE=1 SV=1
3	B9A0M5	2.45e-10	56.2	132	0.302	0.288	B9A0M5_DROME Chibby, isoform E OS=Drosophila melanogaster OX=7227 GN=Cby PE=1 SV=4
4	A0A0B4KHL3	3.23e-09	52.8	108	0.302	0.352	A0A0B4KHL3_DROME Chibby, isoform C OS=Drosophila melanogaster OX=7227 GN=Cby PE=4 SV=1
5	Q4V6B6	3.55e-08	50.4	125	0.262	0.264	Q4V6B6_DROME IP05256p OS=Drosophila melanogaster OX=7227 GN=CG13415 PE=2 SV=1
6	Q32MG2	0.066	34.3	446	0.151	0.043	CBY2_MOUSE Protein chibby homolog 2 OS=Mus musculus OX=10090 GN=Cby2 PE=1 SV=2
7	Q99550	0.38	32.3	1031	0.127	0.016	MPP9_HUMAN M-phase phosphoprotein 9 OS=Homo sapiens OX=9606 GN=MPHOSPH9 PE=1 SV=6
8	Q9NRC6	0.61	32.0	3674	0.159	0.005	SPTN5_HUMAN Spectrin beta chain, non-erythrocytic 5 OS=Homo sapiens OX=9606 GN=SPTBN5 PE=1 SV=2
9	Q8NA61	0.69	31.6	448	0.087	0.025	CBY2_HUMAN Protein chibby homolog 2 OS=Homo sapiens OX=9606 GN=CBY2 PE=1 SV=1
10	A6H5Y1	1.5	30.8	991	0.119	0.015	MPP9_MOUSE M-phase phosphoprotein 9 OS=Mus musculus OX=10090 GN=Mphosph9 PE=2 SV=2
11	Q5PQY9	2.9	29.6	318	0.151	0.060	Q5PQY9_DANRE Muscle-related coiled-coil protein OS=Danio rerio OX=7955 GN=murc PE=1 SV=1
12	Q5GH64	3.2	29.6	580	0.103	0.022	XKR7_MOUSE XK-related protein 7 OS=Mus musculus OX=10090 GN=Xkr7 PE=2 SV=1
13	A0A8I6AJK7	3.9	29.3	1638	0.159	0.012	A0A8I6AJK7_RAT IQ motif containing GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Iqgap1 PE=1 SV=1
14	G3V7Q7	4.1	29.3	1657	0.159	0.012	G3V7Q7_RAT IQ motif containing GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Iqgap1 PE=1 SV=1
15	A4QPB0	4.3	29.3	1657	0.159	0.012	A4QPB0_HUMAN IQ motif containing GTPase activating protein 1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1
16	P46940	4.3	29.3	1657	0.159	0.012	IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1
17	Q9JKF1	4.4	29.3	1657	0.159	0.012	IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus OX=10090 GN=Iqgap1 PE=1 SV=2
18	Q9ESK9	4.7	29.3	1588	0.206	0.016	RBCC1_MOUSE RB1-inducible coiled-coil protein 1 OS=Mus musculus OX=10090 GN=Rb1cc1 PE=1 SV=3
19	B5DFH1	4.9	29.3	969	0.159	0.021	B5DFH1_RAT Iqgap1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Iqgap1 PE=2 SV=1
20	K9IWF9	5.7	28.9	1657	0.159	0.012	K9IWF9_PIG Ras GTPase-activating-like protein IQGAP1 OS=Sus scrofa OX=9823 GN=IQGAP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14645 Chibby	4.3e-42	154.1	Chibby family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000024761

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000044466	0.940	Catenin (Cadherin-associated protein), beta 1, 88kDa
2	9598.ENSPTRP00000052121	0.900	Uncharacterized protein
3	9598.ENSPTRP00000014538	0.895	Pan troglodytes tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide (YWHAE), mRNA
4	9598.ENSPTRP00000040879	0.875	Exportin 1
5	9598.ENSPTRP00000060143	0.803	Family with sequence similarity 92, member A1
6	9598.ENSPTRP00000020019	0.797	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
7	9598.ENSPTRP00000056936	0.795	Uncharacterized protein
8	9598.ENSPTRP00000024600	0.787	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
9	9598.ENSPTRP00000033045	0.758	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
10	9598.ENSPTRP00000003185	0.694	Major facilitator superfamily domain containing 4
11	9598.ENSPTRP00000007816	0.694	Amiloride-sensitive sodium channel subunit alpha
12	9598.ENSPTRP00000015634	0.694	Junction plakoglobin
13	9598.ENSPTRP00000059507	0.694	Inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
14	9598.ENSPTRP00000002709	0.676	Uridine-cytidine kinase
15	9598.ENSPTRP00000046353	0.676	Belongs to the uridine kinase family.
16	9598.ENSPTRP00000048764	0.676	Belongs to the uridine kinase family.
17	9598.ENSPTRP00000027941	0.675	Uncharacterized protein
18	9598.ENSPTRP00000032655	0.668	Inhibin, beta A
19	9598.ENSPTRP00000018854	0.631	V-akt murine thymoma viral oncogene homolog 2
20	9598.ENSPTRP00000011569	0.627	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.972	identical protein binding
GO:0098772	0.915	molecular function regulator activity
GO:0140678	0.867	molecular function inhibitor activity
GO:0008013	0.822	beta-catenin binding
GO:0046983	0.814	protein dimerization activity
GO:0042803	0.785	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0048523	0.979	negative regulation of cellular process
GO:0009966	0.978	regulation of signal transduction
GO:0023057	0.968	negative regulation of signaling
GO:0030111	0.962	regulation of Wnt signaling pathway
GO:0022607	0.958	cellular component assembly
GO:0030178	0.882	negative regulation of Wnt signaling pathway
GO:0019222	0.802	regulation of metabolic process
GO:0080090	0.792	regulation of primary metabolic process
GO:0031323	0.792	regulation of cellular metabolic process
GO:0060255	0.789	regulation of macromolecule metabolic process
GO:0051171	0.757	regulation of nitrogen compound metabolic process
GO:0010556	0.737	regulation of macromolecule biosynthetic process
GO:0031326	0.723	regulation of cellular biosynthetic process
GO:0043933	0.628	protein-containing complex organization
GO:0051259	0.605	protein complex oligomerization
GO:0010468	0.602	regulation of gene expression
GO:0051252	0.595	regulation of RNA metabolic process
GO:1903506	0.583	regulation of nucleic acid-templated transcription
GO:0044782	0.559	cilium organization
GO:0070925	0.539	organelle assembly
GO:0006355	0.533	regulation of DNA-templated transcription
GO:0051179	0.501	localization
GO:0051641	0.477	cellular localization
GO:0032501	0.463	multicellular organismal process
GO:0051260	0.459	protein homooligomerization
GO:0009892	0.456	negative regulation of metabolic process
GO:0048856	0.455	anatomical structure development
GO:0031324	0.434	negative regulation of cellular metabolic process
GO:0010605	0.419	negative regulation of macromolecule metabolic process
GO:0120031	0.378	plasma membrane bounded cell projection assembly
GO:0051172	0.376	negative regulation of nitrogen compound metabolic process
GO:0060271	0.369	cilium assembly
GO:0008104	0.340	protein localization
GO:0009890	0.314	negative regulation of biosynthetic process
GO:0050896	0.303	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005814	0.998	centriole
GO:0031974	0.965	membrane-enclosed lumen
GO:0005737	0.959	cytoplasm
GO:0070013	0.958	intracellular organelle lumen
GO:0005829	0.943	cytosol
GO:0005634	0.938	nucleus
GO:0031981	0.927	nuclear lumen
GO:0005654	0.896	nucleoplasm
GO:0120025	0.893	plasma membrane bounded cell projection
GO:0012505	0.880	endomembrane system
GO:0005929	0.774	cilium
GO:0036064	0.529	ciliary basal body
GO:0031984	0.487	organelle subcompartment
GO:0005794	0.442	Golgi apparatus
GO:0098791	0.338	Golgi apparatus subcompartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]