StarFunc result for job id Q9Y3M8

User Input

>input (1113 residues)
MFSQVPRTPASGCYYLNSMTPEGQEMYLRFDQTTRRSPYRMSRILARHQLVTKIQQEIEA
KEACDWLRAAGFPQYAQLYEDSQFPINIVAVKNDHDFLEKDLVEPLCRRLNTLNKCASMK
LDVNFQRKKGDDSDEEDLCISNKWTFQRTSRRWSRVDDLYTLLPRGDRNGSPGGTGMRNT
TSSESVLTDLSEPEVCSIHSESSGGSDSRSQPGQCCTDNPVMLDAPLVSSSLPQPPRDVL
NHPFHPKNEKPTRARAKSFLKRMETLRGKGAHGRHKGSGRTGGLVISGPMLQQEPESFKA
MQCIQIPNGDLQNSPPPACRKGLPCSGKSSGESSPSEHSSSGVSTPCLKERKCHEANKRG
GMYLEDLDVLAGTALPDAGDQSRMHEFHSQENLVVHIPKDHKPGTFPKALSIESLSPTDS
SNGVNWRTGSISLGREQVPGAREPRLMASCHRASRVSIYDNVPGSHLYASTGDLLDLEKD
DLFPHLDDILQHVNGLQEVVDDWSKDVLPELQTHDTLVGEPGLSTFPSPNQITLDFEGNS
VSEGRTTPSDVERDVTSLNESEPPGVRDRRDSGVGASLTRPNRRLRWNSFQLSHQPRPAP
ASPHISSQTASQLSLLQRFSLLRLTAIMEKHSMSNKHGWTWSVPKFMKRMKVPDYKDKAV
FGVPLIVHVQRTGQPLPQSIQQALRYLRSNCLDQVGLFRKSGVKSRIHALRQMNENFPEN
VNYEDQSAYDVADMVKQFFRDLPEPLFTNKLSETFLHIYQYVSKEQRLQAVQAAILLLAD
ENREVLQTLLCFLNDVVNLVEENQMTPMNLAVCLAPSLFHLNLLKKESSPRVIQKKYATG
KPDQKDLNENLAAAQGLAHMIMECDRLFEVPHELVAQSRNSYVEAEIHVPTLEELGTQLE
ESGATFHTYLNHLIQGLQKEAKEKFKGWVTCSSTDNTDLAFKKVGDGNPLKLWKASVEVE
APPSVVLNRVLRERHLWDEDFVQWKVVETLDRQTEIYQYVLNSMAPHPSRDFVVLRTWKT
DLPKGMCTLVSLSVEHEEAQLLGGVRAVVMDSQYLIEPCGSGKSRLTHICRIDLKGHSPE
WYSKGFGHLCAAEVARIRNSFQPLIAEGPETKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q923Q2	0.670	0.670	0.000	1113	0.895	0.895	Q923Q2.pdb.gz	STA13_MOUSE StAR-related lipid transfer protein 13 OS=Mus musculus OX=10090 GN=Stard13 PE=1 SV=5
2	AFDB:Q9Y3M8	1.000	1.000	0.000	1113	1.000	1.000	Q9Y3M8.pdb.gz	STA13_HUMAN StAR-related lipid transfer protein 13 OS=Homo sapiens OX=9606 GN=STARD13 PE=1 SV=2
3	AFDB:Q20440	0.410	0.305	8.289E-50	1510	0.273	0.201	Q20440.pdb.gz	Q20440_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=1 SV=5
4	PDB:2r55A	0.162	0.786	2.137E-11	208	0.033	0.178	2r55A.pdb.gz
5	PDB:6serA	0.155	0.654	6.187E-11	245	0.038	0.171	6serA.pdb.gz
6	PDB:5brlA	0.161	0.772	8.268E-11	210	0.032	0.171	5brlA.pdb.gz
7	PDB:3cxlA	0.168	0.450	2.768E-10	402	0.043	0.119	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
8	PDB:6r3vA	0.161	0.850	3.358E-10	198	0.049	0.273	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
9	PDB:6l1dA	0.159	0.813	5.445E-10	200	0.028	0.155	6l1dA.pdb.gz
10	AFDB:Q13459	0.162	0.087	1.733E-9	2157	0.148	0.076	Q13459.pdb.gz	MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3
11	AFDB:Q6DFV3	0.148	0.086	4.557E-9	1944	0.111	0.063	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
12	PDB:5jcpA	0.150	0.439	4.792E-9	361	0.047	0.144	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
13	PDB:1ln1A	0.138	0.644	2.043E-8	203	0.026	0.143	1ln1A.pdb.gz	Structure of human phosphatidylcholine transfer protein in complex with its ligand.
14	AFDB:E7F3F0	0.171	0.088	2.473E-8	2286	0.112	0.055	E7F3F0.pdb.gz	MY9AB_DANRE Unconventional myosin-IXAb OS=Danio rerio OX=7955 GN=myo9ab PE=3 SV=3
15	PDB:1xa6A	0.165	0.447	3.312E-8	399	0.040	0.113	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
16	AFDB:P34288	0.148	0.105	6.615E-7	1605	0.101	0.070	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
17	PDB:5c2kA	0.155	0.428	1.242E-6	382	0.034	0.099	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
18	AFDB:Q06407	0.143	0.157	4.151E-6	1009	0.120	0.133	Q06407.pdb.gz	RGA2_YEAST Rho-type GTPase-activating protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA2 PE=1 SV=1
19	AFDB:Q9VDE9	0.149	0.126	9.439E-6	1330	0.119	0.099	Q9VDE9.pdb.gz	Q9VDE9_DROME FI04035p OS=Drosophila melanogaster OX=7227 GN=RhoGAP93B PE=2 SV=2
20	AFDB:A0A1D8PLJ2	0.146	0.143	3.328E-2	1141	0.112	0.110	A0A1D8PLJ2.pdb.gz	A0A1D8PLJ2_CANAL Bem3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BEM3 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63744	0.0	1093	1091	0.539	0.550	RHG07_RAT Rho GTPase-activating protein 7 OS=Rattus norvegicus OX=10116 GN=Dlc1 PE=1 SV=3
2	Q923Q2	0.0	2064	1113	0.896	0.896	STA13_MOUSE StAR-related lipid transfer protein 13 OS=Mus musculus OX=10090 GN=Stard13 PE=1 SV=5
3	Q96QB1	0.0	1093	1528	0.544	0.396	RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens OX=9606 GN=DLC1 PE=1 SV=4
4	Q9R0Z9	0.0	1096	1092	0.540	0.550	RHG07_MOUSE Rho GTPase-activating protein 7 OS=Mus musculus OX=10090 GN=Dlc1 PE=1 SV=2
5	Q9Y3M8	0.0	2317	1113	1.000	1.000	STA13_HUMAN StAR-related lipid transfer protein 13 OS=Homo sapiens OX=9606 GN=STARD13 PE=1 SV=2
6	Q9VFK2	2.87e-149	474	1017	0.222	0.243	Q9VFK2_DROME Crossveinless c, isoform A OS=Drosophila melanogaster OX=7227 GN=cv-c PE=2 SV=2
7	Q8SY28	9.77e-149	473	1017	0.221	0.242	Q8SY28_DROME RE02250p OS=Drosophila melanogaster OX=7227 GN=cv-c PE=2 SV=1
8	A8JR05	2.28e-143	479	2351	0.226	0.107	A8JR05_DROME Crossveinless c, isoform C OS=Drosophila melanogaster OX=7227 GN=cv-c PE=4 SV=1
9	C7FZT8	1.69e-93	328	1341	0.180	0.149	C7FZT8_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=1 SV=1
10	Q20442	2.65e-93	328	1334	0.180	0.150	Q20442_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=1 SV=4
11	Q20440	6.46e-93	328	1510	0.180	0.132	Q20440_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=1 SV=5
12	C0P276	1.80e-39	148	228	0.074	0.360	C0P276_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=4 SV=1
13	Q8K0Q5	3.62e-22	105	663	0.072	0.121	RHG18_MOUSE Rho GTPase-activating protein 18 OS=Mus musculus OX=10090 GN=Arhgap18 PE=1 SV=1
14	Q8N392	1.28e-21	103	663	0.085	0.143	RHG18_HUMAN Rho GTPase-activating protein 18 OS=Homo sapiens OX=9606 GN=ARHGAP18 PE=1 SV=3
15	Q5TG30	1.17e-18	93.6	622	0.066	0.119	RHG40_HUMAN Rho GTPase-activating protein 40 OS=Homo sapiens OX=9606 GN=ARHGAP40 PE=3 SV=3
16	O43052	6.01e-17	89.0	1150	0.066	0.063	RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga1 PE=1 SV=1
17	E7EQN5	1.08e-16	88.2	925	0.054	0.065	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
18	E9PCM6	1.21e-16	87.8	768	0.054	0.078	E9PCM6_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
19	P98171	1.53e-16	87.4	946	0.054	0.063	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
20	O54834	1.64e-16	87.4	987	0.061	0.069	RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus OX=10090 GN=Arhgap6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00620 RhoGAP	6e-33	125.2	RhoGAP domain
2	PF07647 SAM_2	0.013	26.9	SAM domain (Sterile alpha motif)
3	PF01852 START	3.4e-37	139.4	START domain
4	PF20175 Tra1_central	0.74	20.0	Tra1 HEAT repeat central region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338785

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.838	Transforming protein RhoA
2	9606.ENSP00000382423	0.796	Mitogen-activated protein kinase kinase kinase 1
3	9606.ENSP00000252655	0.764	Radial spoke head protein 3 homolog
4	9606.ENSP00000260363	0.762	Kinesin-like protein KIF23
5	9606.ENSP00000303246	0.716	Acyl-coenzyme A thioesterase 12
6	9606.ENSP00000338030	0.703	StAR-related lipid transfer protein 7, mitochondrial
7	9606.ENSP00000383118	0.702	Cell division control protein 42 homolog
8	9606.ENSP00000319756	0.691	Tensin-2
9	9606.ENSP00000285735	0.685	Rho-related GTP-binding protein RhoC
10	9606.ENSP00000298694	0.679	Rho guanine nucleotide exchange factor 40
11	9606.ENSP00000462349	0.664	StAR-related lipid transfer protein 6
12	9606.ENSP00000411565	0.663	Dehydrogenase/reductase SDR family member 12
13	9606.ENSP00000354451	0.657	Ras GTPase-activating-like protein IQGAP3
14	9606.ENSP00000358894	0.642	Metal transporter CNNM2
15	9606.ENSP00000360366	0.620	Acyl-coenzyme A thioesterase 11
16	9606.ENSP00000268896	0.617	Phosphatidylcholine transfer protein
17	9606.ENSP00000335247	0.609	START domain-containing protein 10
18	9606.ENSP00000290607	0.607	StAR-related lipid transfer protein 9
19	9606.ENSP00000296632	0.607	StAR-related lipid transfer protein 4
20	9606.ENSP00000171887	0.600	Tensin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0009987	0.986	cellular process
GO:0050794	0.980	regulation of cellular process
GO:0051056	0.971	regulation of small GTPase mediated signal transduction
GO:0032501	0.915	multicellular organismal process
GO:0032502	0.906	developmental process
GO:0048519	0.905	negative regulation of biological process
GO:0048856	0.904	anatomical structure development
GO:0007275	0.867	multicellular organism development
GO:0048523	0.854	negative regulation of cellular process
GO:0071840	0.831	cellular component organization or biogenesis
GO:0040013	0.828	negative regulation of locomotion
GO:0016043	0.820	cellular component organization
GO:0030334	0.811	regulation of cell migration
GO:0050896	0.765	response to stimulus
GO:0009653	0.741	anatomical structure morphogenesis
GO:0030336	0.725	negative regulation of cell migration
GO:0051239	0.711	regulation of multicellular organismal process
GO:0048731	0.703	system development
GO:0016477	0.678	cell migration
GO:2000181	0.659	negative regulation of blood vessel morphogenesis
GO:0051716	0.603	cellular response to stimulus
GO:0035239	0.587	tube morphogenesis
GO:0009888	0.570	tissue development
GO:0090130	0.552	tissue migration
GO:0048729	0.548	tissue morphogenesis
GO:0002009	0.532	morphogenesis of an epithelium
GO:0016525	0.498	negative regulation of angiogenesis
GO:0060562	0.491	epithelial tube morphogenesis
GO:0090132	0.473	epithelium migration
GO:0007165	0.418	signal transduction
GO:0043542	0.393	endothelial cell migration
GO:0048518	0.343	positive regulation of biological process
GO:0048522	0.311	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.954	organelle
GO:0016020	0.929	membrane
GO:0043229	0.929	intracellular organelle
GO:0071944	0.582	cell periphery
GO:0030054	0.518	cell junction
GO:0043232	0.458	intracellular non-membrane-bounded organelle
GO:0043231	0.406	intracellular membrane-bounded organelle
GO:0070161	0.331	anchoring junction
GO:0005925	0.323	focal adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]