StarFunc result for job id Q9Y3P4

User Input

>input (386 residues)
MHARGPHGQLSPALPLASSVLMLLMSTLWLVGAGPGLVLAPELLLDPWQVHRLLTHALGH
TALPGLLLSLLLLPTVGWQQECHLGTLRFLHASALLALASGLLAVLLAGLGLSSAAGSCG
YMPVHLAMLAGEGHRPRRPRGALPPWLSPWLLLALTPLLSSEPPFLQLLCGLLAGLAYAA
GAFRWLEPSERRLQVLQEGVLCRTLAGCWPLRLLATPGSLAELPVTHPAGVRPPIPGPPY
VASPDLWSHWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEG
IQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATGRVEGAVSLLV
GGQVGTETLVTHGKGGPAHSEGPGPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BP97	0.617	0.618	4.094E-43	385	0.756	0.758	Q8BP97.pdb.gz	RHBD3_MOUSE Rhomboid domain-containing protein 3 OS=Mus musculus OX=10090 GN=Rhbdd3 PE=2 SV=1
2	AFDB:F4J5V3	0.466	0.425	1.672E-13	426	0.207	0.188	F4J5V3.pdb.gz	F4J5V3_ARATH RHOMBOID-like protein 15 OS=Arabidopsis thaliana OX=3702 GN=RBL15 PE=1 SV=1
3	AFDB:Q6NTF9	0.487	0.515	2.589E-10	364	0.228	0.242	Q6NTF9.pdb.gz	RHBD2_HUMAN Rhomboid domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RHBDD2 PE=1 SV=2
4	AFDB:Q8VEK2	0.491	0.523	2.589E-10	361	0.246	0.263	Q8VEK2.pdb.gz	RHBD2_MOUSE Rhomboid domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rhbdd2 PE=1 SV=1
5	AFDB:Q12270	0.453	0.649	4.910E-7	262	0.119	0.176	Q12270.pdb.gz	RBD2_YEAST Rhomboid-type serine protease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RBD2 PE=1 SV=1
6	AFDB:Q9LET3	0.361	0.459	1.982E-5	293	0.155	0.205	Q9LET3.pdb.gz	RBL20_ARATH Rhomboid-like protein 20 OS=Arabidopsis thaliana OX=3702 GN=RBL20 PE=2 SV=1
7	AFDB:Q8RXW0	0.405	0.461	2.553E-5	334	0.145	0.168	Q8RXW0.pdb.gz	RBL14_ARATH Rhomboid-like protein 14, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RBL14 PE=2 SV=1
8	AFDB:Q9UTK7	0.349	0.360	2.972E-5	372	0.140	0.145	Q9UTK7.pdb.gz	DSC2_SCHPO DSC E3 ubiquitin ligase complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dsc2 PE=1 SV=1
9	AFDB:Q9P375	0.430	0.617	8.185E-5	258	0.080	0.120	Q9P375.pdb.gz	YLM6_SCHPO Uncharacterized rhomboid protein C19B12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC19B12.06c PE=3 SV=2
10	PDB:2nr9A	0.349	0.647	2.286E-3	192	0.091	0.182	2nr9A.pdb.gz	The crystal structure of the rhomboid peptidase from Haemophilus influenzae provides insight into intramembrane proteolysis.
11	AFDB:Q382S2	0.317	0.451	5.482E-3	253	0.111	0.170	Q382S2.pdb.gz	Q382S2_TRYB2 Derlin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4430 PE=3 SV=1
12	PDB:3odjA	0.309	0.703	4.102E-2	157	0.070	0.172	3odjA.pdb.gz
13	PDB:7czbA	0.317	0.570	4.539E-2	194	0.093	0.186	7czbA.pdb.gz
14	PDB:7r0cA	0.125	0.146	1.531E-1	284	0.114	0.155	7r0cA.pdb.gz	Structure of the vasopressin hormone-V2 receptor-beta-arrestin1 ternary complex.
15	PDB:6b2za	0.080	0.118	6.997E-1	249	0.067	0.104	6b2za.pdb.gz	Atomic model for the dimeric FO region of mitochondrial ATP synthase.
16	PDB:7ew2R	0.115	0.131	1.049	290	0.091	0.121	7ew2R.pdb.gz	Structural insights into sphingosine-1-phosphate recognition and ligand selectivity of S1PR3-Gi signaling complexes.
17	PDB:3ihpB	0.101	0.058	1.161	681	0.044	0.025	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
18	PDB:4u14A	0.128	0.117	1.161	436	0.054	0.048	4u14A.pdb.gz	Modified T4 Lysozyme Fusion Proteins Facilitate G Protein-Coupled Receptor Crystallogenesis.
19	PDB:7w56R	0.154	0.193	1.161	276	0.080	0.112	7w56R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
20	PDB:5c05B	0.145	0.121	1.222	522	0.067	0.050	5c05B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BP97	9.79e-148	425	385	0.756	0.758	RHBD3_MOUSE Rhomboid domain-containing protein 3 OS=Mus musculus OX=10090 GN=Rhbdd3 PE=2 SV=1
2	F4J5V3	1.69e-12	70.9	426	0.140	0.127	F4J5V3_ARATH RHOMBOID-like protein 15 OS=Arabidopsis thaliana OX=3702 GN=RBL15 PE=1 SV=1
3	Q6NTF9	4.34e-09	60.1	364	0.130	0.137	RHBD2_HUMAN Rhomboid domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RHBDD2 PE=1 SV=2
4	Q8VEK2	2.81e-07	54.3	361	0.127	0.136	RHBD2_MOUSE Rhomboid domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rhbdd2 PE=1 SV=1
5	A0A8I6ADR1	2.1	33.1	2708	0.054	0.008	A0A8I6ADR1_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
6	O94685	3.1	32.3	829	0.044	0.021	UCP8_SCHPO UBA domain-containing protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp8 PE=1 SV=2
7	Q9VF53	4.6	32.0	1273	0.041	0.013	Q9VF53_DROME Aldehyde oxidase 1 OS=Drosophila melanogaster OX=7227 GN=AOX1 PE=1 SV=1
8	B0LVF0	4.9	32.0	1219	0.062	0.020	B0LVF0_DANRE SIP1b OS=Danio rerio OX=7955 GN=zfhx1b PE=2 SV=1
9	Q9FU27	5.3	31.6	386	0.054	0.054	C3H2_ORYSJ Zinc finger CCCH domain-containing protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0192000 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11739 DctA-YdbH	7.4e+02	11.2	Dicarboxylate transport
2	PF01694 Rhomboid	0.00051	31.5	Rhomboid family
3	PF00627 UBA	0.0079	27.4	UBA/TS-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216085

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344206	0.823	Rhomboid-related protein 1
2	9606.ENSP00000375914	0.796	Rhomboid-related protein 4
3	9606.ENSP00000322775	0.788	Inactive rhomboid protein 2
4	9606.ENSP00000383911	0.714	Ubiquitin-associated domain-containing protein 2
5	9606.ENSP00000319726	0.712	Promotes the cell surface stability of iRhom1/RHBDF1 and iRhom2/RHBDF2 and prevents their degradation via the endolysosomal pathway. By acting on iRhoms, involved in ADAM17-mediated shedding of TNF, amphiregulin/AREG, HBEGF and TGFA from the cell surface . Negatively regulates Wnt signaling, possibly by antagonizing the recruitment of AXIN1 to LRP6
6	9606.ENSP00000289248	0.711	Rhomboid-related protein 2
7	9606.ENSP00000269051	0.673	Rhomboid-related protein 3
8	9606.ENSP00000338165	0.642	Transmembrane protein 39B
9	9606.ENSP00000216214	0.634	Protein FAM118A
10	9606.ENSP00000262316	0.632	Inactive rhomboid protein 1
11	9606.ENSP00000369291	0.606	LETM1 domain-containing protein LETM2, mitochondrial
12	9606.ENSP00000325421	0.604	Presenilins-associated rhomboid-like protein, mitochondrial
13	9606.ENSP00000483825	0.559	NF-kappa-B essential modulator
14	9606.ENSP00000266025	0.526	Transmembrane protein 115
15	9606.ENSP00000420716	0.519	Uncharacterized protein C1orf228
16	9606.ENSP00000302843	0.512	DnaJ heat shock protein family member C18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.362	catalytic activity
GO:0140096	0.306	catalytic activity, acting on a protein
GO:0016787	0.300	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0009987	0.987	cellular process
GO:0060255	0.962	regulation of macromolecule metabolic process
GO:0050794	0.959	regulation of cellular process
GO:0051049	0.944	regulation of transport
GO:0048519	0.936	negative regulation of biological process
GO:0060341	0.932	regulation of cellular localization
GO:0009894	0.926	regulation of catabolic process
GO:0051223	0.919	regulation of protein transport
GO:0051246	0.912	regulation of protein metabolic process
GO:0048523	0.886	negative regulation of cellular process
GO:0048583	0.880	regulation of response to stimulus
GO:0048518	0.873	positive regulation of biological process
GO:0002682	0.864	regulation of immune system process
GO:0042221	0.821	response to chemical
GO:0051716	0.798	cellular response to stimulus
GO:0007165	0.678	signal transduction
GO:0035556	0.587	intracellular signal transduction
GO:0009893	0.503	positive regulation of metabolic process
GO:0032502	0.498	developmental process
GO:0032501	0.495	multicellular organismal process
GO:0048856	0.490	anatomical structure development
GO:0042176	0.473	regulation of protein catabolic process
GO:0008152	0.463	metabolic process
GO:0071704	0.439	organic substance metabolic process
GO:0044238	0.422	primary metabolic process
GO:0010604	0.396	positive regulation of macromolecule metabolic process
GO:0007275	0.387	multicellular organism development
GO:0051239	0.379	regulation of multicellular organismal process
GO:0006807	0.365	nitrogen compound metabolic process
GO:0050727	0.362	regulation of inflammatory response
GO:0051046	0.345	regulation of secretion
GO:0043170	0.341	macromolecule metabolic process
GO:0051173	0.332	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0031090	0.905	organelle membrane
GO:0005783	0.818	endoplasmic reticulum
GO:0071944	0.756	cell periphery
GO:0032991	0.644	protein-containing complex
GO:0070013	0.531	intracellular organelle lumen
GO:0005794	0.516	Golgi apparatus
GO:0005886	0.507	plasma membrane
GO:0005634	0.418	nucleus
GO:0031981	0.376	nuclear lumen
GO:0005829	0.375	cytosol
GO:0005789	0.365	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.300	Hydrolases.

[back to server]