StarFunc result for job id Q9Y3P9

User Input

>input (1069 residues)
MDDKASVGKISVSSDSVSTLNSEDFVLVSRQGDETPSTNNGSDDEKTGLKIVGNGSEQQL
QKELADVLMDPPMDDQPGEKELVKRSQLDGEGDGPLSNQLSASSTINPVPLVGLQKPEMS
LPVKPGQGDSEASSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQI
SLDVTLSVPNVSEGIVRLLDPQTNTEIANYPIYKILFCVRGHDGTPESDCFAFTESHYNA
ELFRIHVFRCEIQEAVSRILYSFATAFRRSAKQTPLSATAAPQTPDSDIFTFSVSLEIKE
DDGKGYFSAVPKDKDRQCFKLRQGIDKKIVIYVQQTTNKELAIERCFGLLLSPGKDVRNS
DMHLLDLESMGKSSDGKSYVITGSWNPKSPHFQVVNEETPKDKVLFMTTAVDLVITEVQE
PVRFLLETKVRVCSPNERLFWPFSKRSTTENFFLKLKQIKQRERKNNTDTLYEVVCLESE
SERERRKTTASPSVRLPQSGSQSSVIPSPPEDDEEEDNDEPLLSGSGDVSKECAEKILET
WGELLSKWHLNLNVRPKQLSSLVRNGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKES
PQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLL
HMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEA
HMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGAL
KFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQAQQEDPIERFER
ENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDNAEEKADALNKELLMTKQKLIDAEE
EKRRLEEESAQLKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLEKQQTANKVEIE
KIRQKVDDCERCREFFNKEGRVKGISSTKEVLDEDTDEEKETLKNQLREMELELAQTKLQ
LVEAECKIQDLEHHLGLALNEVQAAKKTWFNRTLSSIKTATGVQGKETC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y3P9	1.000	1.000	0.000	1069	1.000	1.000	Q9Y3P9.pdb.gz	RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3
2	AFDB:H2KZZ6	0.330	0.364	6.513E-81	934	0.353	0.404	H2KZZ6.pdb.gz	TBC11_CAEEL Rab GTPase-activating protein tbc-11 OS=Caenorhabditis elegans OX=6239 GN=tbc-11 PE=1 SV=1
3	AFDB:Q86TI0	0.267	0.246	3.166E-26	1168	0.189	0.173	Q86TI0.pdb.gz	TBCD1_HUMAN TBC1 domain family member 1 OS=Homo sapiens OX=9606 GN=TBC1D1 PE=1 SV=2
4	AFDB:Q60949	0.268	0.231	2.002E-24	1255	0.204	0.174	Q60949.pdb.gz	TBCD1_MOUSE TBC1 domain family member 1 OS=Mus musculus OX=10090 GN=Tbc1d1 PE=1 SV=3
5	AFDB:Q6AWQ6	0.277	0.544	9.181E-20	535	0.103	0.206	Q6AWQ6.pdb.gz	Q6AWQ6_DROME RH06321p (Fragment) OS=Drosophila melanogaster OX=7227 GN=plx PE=2 SV=1
6	AFDB:Q9VGL8	0.264	0.740	8.015E-16	363	0.086	0.253	Q9VGL8.pdb.gz	TBWKD_DROME TBC1 domain family member whacked OS=Drosophila melanogaster OX=7227 GN=wkd PE=1 SV=1
7	AFDB:Q4KMP7	0.261	0.341	2.344E-15	808	0.126	0.167	Q4KMP7.pdb.gz	TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B PE=1 SV=3
8	AFDB:O96904	0.243	0.575	3.267E-14	438	0.080	0.196	O96904.pdb.gz	TBC12_DICDI Drainin OS=Dictyostelium discoideum OX=44689 GN=phgA PE=1 SV=1
9	AFDB:Q8VCZ6	0.250	0.351	5.812E-13	750	0.074	0.105	Q8VCZ6.pdb.gz	SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus OX=10090 GN=Sgsm3 PE=1 SV=1
10	AFDB:Q9P2M4	0.234	0.352	9.467E-13	693	0.137	0.211	Q9P2M4.pdb.gz	TBC14_HUMAN TBC1 domain family member 14 OS=Homo sapiens OX=9606 GN=TBC1D14 PE=1 SV=3
11	PDB:6wskA	0.103	0.318	6.666E-6	287	0.028	0.105	6wskA.pdb.gz
12	PDB:4z6yA	0.193	0.657	4.015E-4	273	0.037	0.147	4z6yA.pdb.gz
13	PDB:7kzpB	0.077	0.109	9.114E-3	701	0.027	0.041	7kzpB.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
14	PDB:1yvlB	0.072	0.109	1.559E-2	653	0.017	0.028	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.
15	PDB:3jroA	0.058	0.076	1.989E-2	701	0.069	0.106	3jroA.pdb.gz
16	PDB:1k5dB	0.080	0.417	2.089E-2	146	0.022	0.164	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
17	PDB:7mq8LR	0.050	0.062	2.666E-2	773	0.053	0.074	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:3m1iB	0.086	0.490	3.402E-2	131	0.017	0.137	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
19	PDB:7uknA	0.050	0.051	3.402E-2	1059	0.035	0.035	7uknA.pdb.gz	Insight into Viral Hijacking of CRL4 Ubiquitin Ligase through Structural Analysis of the pUL145-DDB1 Complex.
20	PDB:7ajtUO	0.061	0.103	4.342E-2	493	0.057	0.124	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LJ00	0.0	1058	815	0.497	0.652	F1LJ00_HUMAN TBC1 domain family, member 18 OS=Homo sapiens OX=9606 GN=TBC1D18 PE=2 SV=1
2	H2KZZ6	0.0	677	934	0.360	0.412	TBC11_CAEEL Rab GTPase-activating protein tbc-11 OS=Caenorhabditis elegans OX=6239 GN=tbc-11 PE=1 SV=1
3	Q5R372	0.0	1058	815	0.497	0.652	RBG1L_HUMAN Rab GTPase-activating protein 1-like OS=Homo sapiens OX=9606 GN=RABGAP1L PE=1 SV=1
4	Q9Y3P9	0.0	2208	1069	1.000	1.000	RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3
5	Q9VYY9	4.01e-81	284	807	0.164	0.217	EVI5_DROME Ecotropic viral integration site 5 ortholog OS=Drosophila melanogaster OX=7227 GN=Evi5 PE=1 SV=3
6	S6F527	2.67e-74	266	888	0.129	0.155	EAT17_CAEEL Rab GTPase-activating protein eat-17 OS=Caenorhabditis elegans OX=6239 GN=eat-17 PE=1 SV=1
7	O60447	4.80e-72	258	810	0.164	0.216	EVI5_HUMAN Ecotropic viral integration site 5 protein homolog OS=Homo sapiens OX=9606 GN=EVI5 PE=1 SV=3
8	Q96CN4	4.54e-69	249	794	0.115	0.155	EVI5L_HUMAN EVI5-like protein OS=Homo sapiens OX=9606 GN=EVI5L PE=1 SV=1
9	A0A3B3IRT3	1.10e-61	231	1054	0.133	0.135	A0A3B3IRT3_HUMAN TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=1
10	O60343	2.31e-61	231	1298	0.133	0.109	TBCD4_HUMAN TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=2
11	Q8BYJ6	1.74e-60	228	1307	0.128	0.105	TBCD4_MOUSE TBC1 domain family member 4 OS=Mus musculus OX=10090 GN=Tbc1d4 PE=1 SV=2
12	D3Z881	1.32e-59	226	1245	0.127	0.109	D3Z881_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=4
13	A0A8I6ABF1	1.33e-59	226	1286	0.127	0.106	A0A8I6ABF1_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=1
14	D3ZGN0	1.35e-59	226	1308	0.127	0.104	D3ZGN0_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=4
15	A0A8I6AT49	1.59e-59	226	1300	0.127	0.105	A0A8I6AT49_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=1
16	D4AC16	2.87e-57	217	1033	0.130	0.135	D4AC16_RAT TBC1 domain family member 1 OS=Rattus norvegicus OX=10116 GN=Tbc1d1 PE=1 SV=2
17	Q86TI0	3.12e-57	218	1168	0.130	0.119	TBCD1_HUMAN TBC1 domain family member 1 OS=Homo sapiens OX=9606 GN=TBC1D1 PE=1 SV=2
18	A0A8I5ZLK4	4.90e-57	218	1240	0.130	0.112	A0A8I5ZLK4_RAT TBC1 domain family member 1 OS=Rattus norvegicus OX=10116 GN=Tbc1d1 PE=4 SV=1
19	A0A8I6AB45	6.06e-57	217	1162	0.130	0.120	A0A8I6AB45_RAT TBC1 domain family member 1 OS=Rattus norvegicus OX=10116 GN=Tbc1d1 PE=4 SV=1
20	A0A8I5ZMX5	6.27e-57	217	1257	0.130	0.111	A0A8I5ZMX5_RAT TBC1 domain family member 1 OS=Rattus norvegicus OX=10116 GN=Tbc1d1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12473 DUF3694	8e-30	115.8	Kinesin protein
2	PF00640 PID	0.077	24.5	Phosphotyrosine interaction domain (PTB/PID)
3	PF08416 PTB	0.71	21.4	Phosphotyrosine-binding domain
4	PF00566 RabGAP-TBC	6.7e-54	194.3	Rab-GTPase-TBC domain
5	PF06785 UPF0242	0.072	24.7	Uncharacterised protein family (UPF0242) N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362751

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311449	0.918	Ras-related protein Rab-6A
2	9606.ENSP00000357842	0.864	Tuftelin
3	9606.ENSP00000346139	0.722	TBC1 domain family member 20
4	9606.ENSP00000285208	0.720	Ras-related protein Rab-6B
5	9606.ENSP00000362774	0.683	Roquin-2
6	9606.ENSP00000244040	0.680	Ras-related protein Rab-22A
7	9606.ENSP00000361731	0.675	TBC1 domain family member 13
8	9606.ENSP00000411418	0.665	Rab3 GTPase-activating protein catalytic subunit
9	9606.ENSP00000362962	0.664	Centriolin
10	9606.ENSP00000263116	0.653	Ras-related protein Rab-36
11	9606.ENSP00000377700	0.640	TBC1 domain family member 23
12	9606.ENSP00000242067	0.595	Protein PTHB1
13	9606.ENSP00000261890	0.587	Ras-related protein Rab-11A
14	9606.ENSP00000310491	0.585	Rho GTPase-activating protein 1
15	9606.ENSP00000264170	0.563	Kynureninase
16	9606.ENSP00000354451	0.562	Ras GTPase-activating-like protein IQGAP3
17	9606.ENSP00000362590	0.562	TBC1 domain family member 22B
18	9606.ENSP00000399415	0.559	Kynurenine--oxoglutarate transaminase 1
19	9606.ENSP00000325690	0.552	Histone-arginine methyltransferase CARM1
20	9606.ENSP00000415968	0.548	Spermatid perinuclear RNA-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015631	1.000	tubulin binding
GO:0031267	1.000	small GTPase binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.991	biological regulation
GO:0043087	0.926	regulation of GTPase activity
GO:0009987	0.845	cellular process
GO:0050789	0.656	regulation of biological process
GO:0050794	0.564	regulation of cellular process
GO:0051179	0.538	localization
GO:0051234	0.477	establishment of localization
GO:0051641	0.422	cellular localization
GO:0006810	0.376	transport
GO:0016192	0.327	vesicle-mediated transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.998	cytosol
GO:0043227	0.996	membrane-bounded organelle
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0032991	0.987	protein-containing complex
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0005856	0.953	cytoskeleton
GO:0012505	0.942	endomembrane system
GO:0016020	0.918	membrane
GO:0015630	0.900	microtubule cytoskeleton
GO:0005815	0.872	microtubule organizing center
GO:0031982	0.741	vesicle
GO:0097708	0.727	intracellular vesicle
GO:0005813	0.702	centrosome
GO:0031410	0.694	cytoplasmic vesicle
GO:0005634	0.673	nucleus
GO:0005768	0.459	endosome
GO:0005794	0.381	Golgi apparatus
GO:0005886	0.326	plasma membrane
GO:0005654	0.308	nucleoplasm
GO:0005875	0.302	microtubule associated complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]