StarFunc result for job id Q9Y3Q4

User Input

>input (1203 residues)
MDKLPPSMRKRLYSLPQQVGAKAWIMDEEEDAEEEGAGGRQDPSRRSIRLRPLPSPSPSA
AAGGTESRSSALGAADSEGPARGAGKSSTNGDCRRFRGSLASLGSRGGGSGGTGSGSSHG
HLHDSAEERRLIAEGDASPGEDRTPPGLAAEPERPGASAQPAASPPPPQQPPQPASASCE
QPSVDTAIKVEGGAAAGDQILPEAEVRLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAV
EREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNV
VSDTFFLIDLVLNFRTGIVVEDNTEIILDPQRIKMKYLKSWFMVDFISSIPVDYIFLIVE
TRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVN
LIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIG
YGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSF
HKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD
PNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGE
ICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSI
LLHKVQHDLNSGVFNYQENEIIQQIVQHDREMAHCAHRVQAAASATPTPTPVIWTPLIQA
PLQAAAATTSVAIALTHHPRLPAAIFRPPPGSGLGNLGAGQTPRHLKRLQSLIPSALGSA
SPASSPSQVDTPSSSSFHIQQLAGFSAPAGLSPLLPSSSSSPPPGACGSPSAPTPSAGVA
ATTIAGFGHFHKALGGSLSSSDSPLLTPLQPGARSPQAAQPSPAPPGARGGLGLPEHFLP
PPPSSRSPSSSPGQLGQPPGELSLGLATGPLSTPETPPRQPEPPSLVAGASGGASPVGFT
PRGGLSPPGHSPGPPRTFPSAPPRASGSHGSLLLPPASSPPPPQVPQRRGTPPLTPGRLT
QDLKLISASQPALPQDGAQTLRRASPHSSGESMAAFPLFPRAGGGSGGSGSSGGLGPPGR
PYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAGPQREPGARPEPVRSKLP
SNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y3Q4	1.000	1.000	0.000	1203	1.000	1.000	Q9Y3Q4.pdb.gz	HCN4_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Homo sapiens OX=9606 GN=HCN4 PE=1 SV=1
2	AFDB:F6NYL9	0.488	0.518	7.302E-91	1130	0.615	0.655	F6NYL9.pdb.gz
3	AFDB:A0A2R8QRD5	0.493	0.553	8.426E-90	1065	0.616	0.696	A0A2R8QRD5.pdb.gz
4	AFDB:B3DJX4	0.302	0.306	3.470E-30	1186	0.190	0.193	B3DJX4.pdb.gz
5	PDB:7rhsA	0.294	0.665	5.425E-24	456	0.103	0.272	7rhsA.pdb.gz
6	PDB:7n15A	0.293	0.597	6.672E-21	520	0.094	0.217	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
7	PDB:7wswA	0.294	0.652	1.149E-19	472	0.078	0.199	7wswA.pdb.gz
8	PDB:7rhsD	0.264	0.587	1.514E-18	441	0.089	0.243	7rhsD.pdb.gz
9	PDB:7o4hB	0.299	0.672	2.161E-18	468	0.099	0.254	7o4hB.pdb.gz
10	PDB:7xufA	0.269	0.586	2.182E-17	476	0.076	0.191	7xufA.pdb.gz
11	PDB:7calA	0.308	0.767	6.345E-17	444	0.071	0.191	7calA.pdb.gz
12	PDB:7o4hD	0.220	0.596	2.806E-14	383	0.071	0.225	7o4hD.pdb.gz
13	PDB:6eo1A	0.114	0.306	3.518E-9	355	0.067	0.228	6eo1A.pdb.gz
14	PDB:4byyA	0.100	0.476	6.922E-8	226	0.036	0.190	4byyA.pdb.gz
15	AFDB:O88427	0.105	0.063	3.793E-7	2365	0.178	0.090	O88427.pdb.gz	CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus OX=10090 GN=Cacna1h PE=1 SV=3
16	AFDB:Q9BX84	0.095	0.067	3.417E-4	2022	0.116	0.069	Q9BX84.pdb.gz	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2
17	AFDB:A0A0R4IFN9	0.103	0.064	6.092E-4	2319	0.156	0.081	A0A0R4IFN9.pdb.gz
18	AFDB:Q15878	0.108	0.067	1.694E-3	2313	0.162	0.084	Q15878.pdb.gz	CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens OX=9606 GN=CACNA1E PE=1 SV=3
19	AFDB:B7YZY1	0.064	0.063	3.020E-3	1229	0.140	0.137	B7YZY1.pdb.gz	B7YZY1_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
20	AFDB:Q54JC7	0.058	0.054	3.301E-3	1347	0.109	0.097	Q54JC7.pdb.gz	Y1197_DICDI Probable serine/threonine-protein kinase DDB_G0288147 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288147 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IRW0	1008	908	0.392	0.519	A0A0R4IRW0_DANRE Hyperpolarization-activated cyclic nucleotide-gated potassium channel 1 OS=Danio rerio OX=7955 GN=LOC100334297 PE=3 SV=1
2	A1Z9N7	677	1327	0.273	0.247	A1Z9N7_DROME I[[h]] channel, isoform E OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
3	A1Z9N8	692	1290	0.273	0.254	A1Z9N8_DROME I[[h]] channel, isoform B OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
4	A1Z9P0	676	601	0.273	0.546	A1Z9P0_DROME I[[h]] channel, isoform I OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
5	B7YZE7	691	1295	0.273	0.253	B7YZE7_DROME I[[h]] channel, isoform F OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
6	B7YZE8	680	1322	0.273	0.248	B7YZE8_DROME I[[h]] channel, isoform G OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
7	O60741	1011	890	0.392	0.529	HCN1_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Homo sapiens OX=9606 GN=HCN1 PE=1 SV=3
8	O70507	1847	1186	0.919	0.933	HCN4_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Mus musculus OX=10090 GN=Hcn4 PE=1 SV=2
9	O88703	1042	863	0.430	0.599	HCN2_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Mus musculus OX=10090 GN=Hcn2 PE=1 SV=1
10	O88704	1010	910	0.398	0.526	HCN1_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Mus musculus OX=10090 GN=Hcn1 PE=1 SV=1
11	O88705	958	779	0.387	0.598	HCN3_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 OS=Mus musculus OX=10090 GN=Hcn3 PE=1 SV=1
12	Q56JH7	678	1319	0.273	0.249	Q56JH7_DROME Hyperpolarization-activated ion channel variant DMIH-A1B2C2 OS=Drosophila melanogaster OX=7227 GN=Ih PE=2 SV=1
13	Q56JH8	675	627	0.273	0.523	Q56JH8_DROME Hyperpolarization-activated ion channel variant DMIH-A3B1C1 OS=Drosophila melanogaster OX=7227 GN=Ih PE=2 SV=1
14	Q56JH9	675	618	0.273	0.531	Q56JH9_DROME Hyperpolarization-activated ion channel variant DMIH-A2B1C1 OS=Drosophila melanogaster OX=7227 GN=Ih PE=2 SV=1
15	Q56JI0	692	1282	0.273	0.256	Q56JI0_DROME Hyperpolarization-activated ion channel variant DMIH-A1B1C1 OS=Drosophila melanogaster OX=7227 GN=Ih PE=2 SV=1
16	Q9JKA7	1887	1198	0.928	0.932	HCN4_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Rattus norvegicus OX=10116 GN=Hcn4 PE=1 SV=1
17	Q9JKA8	957	780	0.385	0.594	HCN3_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 OS=Rattus norvegicus OX=10116 GN=Hcn3 PE=1 SV=1
18	Q9JKA9	1040	863	0.431	0.600	HCN2_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Rattus norvegicus OX=10116 GN=Hcn2 PE=1 SV=3
19	Q9JKB0	1011	910	0.398	0.526	HCN1_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Rattus norvegicus OX=10116 GN=Hcn1 PE=2 SV=1
20	Q9P1Z3	955	774	0.387	0.601	HCN3_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 OS=Homo sapiens OX=9606 GN=HCN3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	2.6e-14	64.4	Cyclic nucleotide-binding domain
2	PF00520 Ion_trans	1.1e-19	82.2	Ion transport protein
3	PF07885 Ion_trans_2	26	16.1	Ion channel
4	PF08412 Ion_trans_N	3.5e-17	73.0	Ion transport protein N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261917

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251287	0.954	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
2	9606.ENSP00000419975	0.866	PEX5-related protein
3	9606.ENSP00000364586	0.857	Sodium channel protein type 2 subunit alpha
4	9606.ENSP00000410257	0.840	Sodium channel protein type 5 subunit alpha
5	9606.ENSP00000341940	0.821	Caveolin-3
6	9606.ENSP00000307342	0.819	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1
7	9606.ENSP00000327758	0.785	Homeobox protein Nkx-2.5
8	9606.ENSP00000484552	0.770	Gap junction alpha-5 protein
9	9606.ENSP00000282561	0.749	Gap junction alpha-1 protein
10	9606.ENSP00000358677	0.742	T-box transcription factor TBX18
11	9606.ENSP00000257566	0.736	T-box transcription factor TBX3
12	9606.ENSP00000374240	0.735	Short stature homeobox protein 2
13	9606.ENSP00000355533	0.725	Ryanodine receptor 2
14	9606.ENSP00000243457	0.719	Inward rectifier potassium channel 2
15	9606.ENSP00000266376	0.718	Voltage-dependent L-type calcium channel subunit alpha-1C
16	9606.ENSP00000309913	0.716	T-box transcription factor TBX5
17	9606.ENSP00000284240	0.709	Thy-1 membrane glycoprotein
18	9606.ENSP00000290310	0.705	Potassium voltage-gated channel subfamily E member 2
19	9606.ENSP00000313172	0.705	Blood vessel epicardial substance
20	9606.ENSP00000357342	0.703	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005249	1.000	voltage-gated potassium channel activity
GO:0005248	0.999	voltage-gated sodium channel activity
GO:0005221	0.999	intracellular cyclic nucleotide activated monoatomic cation channel activity
GO:0042802	0.976	identical protein binding
GO:0005222	0.788	intracellular cAMP-activated cation channel activity
GO:0086041	0.558	voltage-gated potassium channel activity involved in SA node cell action potential depolarization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0032501	0.991	multicellular organismal process
GO:0050896	0.984	response to stimulus
GO:0051716	0.965	cellular response to stimulus
GO:0042221	0.949	response to chemical
GO:0008016	0.943	regulation of heart contraction
GO:0006811	0.939	monoatomic ion transport
GO:0042391	0.937	regulation of membrane potential
GO:1901700	0.926	response to oxygen-containing compound
GO:0014070	0.925	response to organic cyclic compound
GO:0009719	0.924	response to endogenous stimulus
GO:0098662	0.923	inorganic cation transmembrane transport
GO:0070887	0.915	cellular response to chemical stimulus
GO:0071495	0.893	cellular response to endogenous stimulus
GO:0071407	0.892	cellular response to organic cyclic compound
GO:0098655	0.884	monoatomic cation transmembrane transport
GO:0048856	0.880	anatomical structure development
GO:1901701	0.873	cellular response to oxygen-containing compound
GO:0061337	0.856	cardiac conduction
GO:0006813	0.850	potassium ion transport
GO:0007154	0.843	cell communication
GO:0003254	0.790	regulation of membrane depolarization
GO:0006814	0.783	sodium ion transport
GO:0007275	0.771	multicellular organism development
GO:0001508	0.739	action potential
GO:0002027	0.729	regulation of heart rate
GO:0086001	0.721	cardiac muscle cell action potential
GO:0110096	0.717	cellular response to aldehyde
GO:0090257	0.709	regulation of muscle system process
GO:0014074	0.689	response to purine-containing compound
GO:1903115	0.685	regulation of actin filament-based movement
GO:0003008	0.674	system process
GO:0046683	0.668	response to organophosphorus
GO:0071320	0.664	cellular response to cAMP
GO:0023052	0.660	signaling
GO:0006937	0.616	regulation of muscle contraction
GO:0006942	0.609	regulation of striated muscle contraction
GO:0003012	0.589	muscle system process
GO:0006936	0.582	muscle contraction
GO:0055117	0.546	regulation of cardiac muscle contraction
GO:1901654	0.545	response to ketone
GO:0033993	0.524	response to lipid
GO:0009725	0.510	response to hormone
GO:0098739	0.460	import across plasma membrane
GO:0048545	0.446	response to steroid hormone
GO:0086065	0.423	cell communication involved in cardiac conduction
GO:0007267	0.409	cell-cell signaling
GO:0051899	0.406	membrane depolarization
GO:0086004	0.384	regulation of cardiac muscle cell contraction
GO:0098659	0.376	inorganic cation import across plasma membrane
GO:0048518	0.375	positive regulation of biological process
GO:0071805	0.370	potassium ion transmembrane transport
GO:0071396	0.350	cellular response to lipid
GO:0010646	0.347	regulation of cell communication
GO:0003013	0.338	circulatory system process
GO:0060047	0.334	heart contraction
GO:0035725	0.327	sodium ion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.993	protein-containing complex
GO:0005737	0.985	cytoplasm
GO:0098796	0.952	membrane protein complex
GO:1902495	0.944	transmembrane transporter complex
GO:0098797	0.940	plasma membrane protein complex
GO:0034703	0.933	cation channel complex
GO:0034705	0.871	potassium channel complex
GO:0120025	0.857	plasma membrane bounded cell projection
GO:0043005	0.848	neuron projection
GO:0008076	0.844	voltage-gated potassium channel complex
GO:0030424	0.765	axon
GO:0043226	0.634	organelle
GO:0043229	0.549	intracellular organelle
GO:0043227	0.533	membrane-bounded organelle
GO:0030054	0.416	cell junction
GO:0098855	0.386	HCN channel complex
GO:0045202	0.357	synapse
GO:0098590	0.349	plasma membrane region
GO:0036477	0.347	somatodendritic compartment
GO:0043231	0.335	intracellular membrane-bounded organelle
GO:0070013	0.335	intracellular organelle lumen
GO:0048471	0.308	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)
RHEA:34963	0.999	Na(+)(in) = Na(+)(out)

[back to server]