StarFunc result for job id Q9Y3Q8

User Input

>input (395 residues)
MSGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPDPGGKGTPRN
GSPPPGAPSSRFRVVKLPHGLGEPYRRGRWTCVDVYERDLEPHSFGGLLEGIRGASGGAG
GRSLDSRLELASLGLGAPTPPSGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLVVPSKAK
AEKPPLSASSPQQRPPEPETGESAGTSRAATPLPSLRVEAEAGGSGARTPPLSRRKAVDM
RLRMELGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSPDPFGAVAAQKFSLAHSMLAI
SGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRELAERNAALEQ
ENGLLRALASPEQLAQLPSSGVPRLGPPAPNGPSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y3Q8	0.999	0.999	8.990E-57	395	1.000	1.000	Q9Y3Q8.pdb.gz	T22D4_HUMAN TSC22 domain family protein 4 OS=Homo sapiens OX=9606 GN=TSC22D4 PE=1 SV=2
2	AFDB:Q9EQN3	0.278	0.283	2.131E-44	387	0.846	0.863	Q9EQN3.pdb.gz	T22D4_MOUSE TSC22 domain family protein 4 OS=Mus musculus OX=10090 GN=Tsc22d4 PE=1 SV=2
3	AFDB:P62500	0.176	0.075	6.521E-8	1077	0.296	0.109	P62500.pdb.gz	T22D1_MOUSE TSC22 domain family protein 1 OS=Mus musculus OX=10090 GN=Tsc22d1 PE=1 SV=2
4	AFDB:Q15714	0.173	0.070	2.837E-7	1073	0.299	0.110	Q15714.pdb.gz	T22D1_HUMAN TSC22 domain family protein 1 OS=Homo sapiens OX=9606 GN=TSC22D1 PE=1 SV=3
5	AFDB:Q84LG2	0.142	0.144	2.749E-2	389	0.182	0.185	Q84LG2.pdb.gz	BZP68_ARATH bZIP transcription factor 68 OS=Arabidopsis thaliana OX=3702 GN=BZIP68 PE=1 SV=1
6	AFDB:Q501B2	0.095	0.094	4.488E-2	409	0.175	0.169	Q501B2.pdb.gz	BZP16_ARATH bZIP transcription factor 16 OS=Arabidopsis thaliana OX=3702 GN=BZIP16 PE=1 SV=1
7	AFDB:Q6P2H3	0.103	0.063	1.583E-1	762	0.177	0.092	Q6P2H3.pdb.gz	CEP85_HUMAN Centrosomal protein of 85 kDa OS=Homo sapiens OX=9606 GN=CEP85 PE=1 SV=1
8	AFDB:Q9CAA9	0.092	0.079	2.583E-1	486	0.165	0.134	Q9CAA9.pdb.gz	BH049_ARATH Transcription factor bHLH49 OS=Arabidopsis thaliana OX=3702 GN=BHLH49 PE=1 SV=1
9	AFDB:Q63850	0.127	0.097	2.972E-1	526	0.134	0.101	Q63850.pdb.gz	NUP62_MOUSE Nuclear pore glycoprotein p62 OS=Mus musculus OX=10090 GN=Nup62 PE=1 SV=2
10	AFDB:A0A024QZF1	0.141	0.114	3.418E-1	522	0.172	0.130	A0A024QZF1.pdb.gz
11	PDB:7ajuCL	0.085	0.048	3.139	808	0.041	0.020	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:7d63RJ	0.145	0.074	5.125	796	0.041	0.020	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
13	PDB:7mqaSI	0.096	0.058	5.125	803	0.030	0.015	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:6yxyBJ	0.056	0.073	5.895	293	0.030	0.041	6yxyBJ.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
15	PDB:7ajtCL	0.145	0.075	6.781	781	0.041	0.020	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:6exnO	0.080	0.094	7.800	320	0.053	0.066	6exnO.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
17	PDB:5lj5O	0.094	0.126	8.366	283	0.043	0.060	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IV54	0.0	600	310	0.782	0.997	Q8IV54_HUMAN TSC22D4 protein OS=Homo sapiens OX=9606 GN=TSC22D4 PE=1 SV=1
2	Q9EQN3	0.0	577	387	0.846	0.863	T22D4_MOUSE TSC22 domain family protein 4 OS=Mus musculus OX=10090 GN=Tsc22d4 PE=1 SV=2
3	Q9Y3Q8	0.0	768	395	1.000	1.000	T22D4_HUMAN TSC22 domain family protein 4 OS=Homo sapiens OX=9606 GN=TSC22D4 PE=1 SV=2
4	Q9CVK3	2.06e-32	120	124	0.149	0.476	Q9CVK3_MOUSE TSC22 domain family protein 2 OS=Mus musculus OX=10090 GN=Tsc22d2 PE=2 SV=2
5	Q99576	8.22e-31	116	134	0.162	0.478	T22D3_HUMAN TSC22 domain family protein 3 OS=Homo sapiens OX=9606 GN=TSC22D3 PE=1 SV=2
6	Q148S0	1.17e-29	121	454	0.149	0.130	Q148S0_MOUSE Tsc22d2 protein OS=Mus musculus OX=10090 GN=Tsc22d2 PE=2 SV=1
7	Q9EQZ1	3.97e-29	112	134	0.134	0.396	T22D3_RAT TSC22 domain family protein 3 OS=Rattus norvegicus OX=10116 GN=Tsc22d3 PE=1 SV=1
8	Q9Z2S7	8.57e-29	111	137	0.134	0.387	T22D3_MOUSE TSC22 domain family protein 3 OS=Mus musculus OX=10090 GN=Tsc22d3 PE=1 SV=2
9	Q6NTI0	2.10e-28	110	143	0.134	0.371	Q6NTI0_DANRE TSC22 domain family protein 3 isoform 1 OS=Danio rerio OX=7955 GN=zgc:64189 PE=2 SV=1
10	P62501	4.24e-28	109	143	0.139	0.385	T22D1_RAT TSC22 domain family protein 1 OS=Rattus norvegicus OX=10116 GN=Tsc22d1 PE=2 SV=2
11	P62500	1.26e-26	114	1077	0.129	0.047	T22D1_MOUSE TSC22 domain family protein 1 OS=Mus musculus OX=10090 GN=Tsc22d1 PE=1 SV=2
12	Q15714	1.98e-26	114	1073	0.134	0.049	T22D1_HUMAN TSC22 domain family protein 1 OS=Homo sapiens OX=9606 GN=TSC22D1 PE=1 SV=3
13	E9Q7M2	2.11e-25	110	769	0.147	0.075	T22D2_MOUSE TSC22 domain family protein 2 OS=Mus musculus OX=10090 GN=Tsc22d2 PE=1 SV=1
14	Q3U1C5	1.14e-18	82.4	87	0.099	0.448	Q3U1C5_MOUSE TSC22 domain family protein 2 OS=Mus musculus OX=10090 GN=Tsc22d2 PE=2 SV=1
15	Q24522	1.57e-17	82.8	219	0.099	0.178	BUN1_DROME Protein bunched, class 1/class 3/D/E isoforms OS=Drosophila melanogaster OX=7227 GN=bun PE=2 SV=2
16	Q24523	4.07e-16	82.8	1331	0.104	0.031	BUN2_DROME Protein bunched, class 2/F/G isoform OS=Drosophila melanogaster OX=7227 GN=bun PE=2 SV=4
17	Q9VQB6	0.022	39.7	971	0.068	0.028	Q9VQB6_DROME Ataxin 7, isoform A OS=Drosophila melanogaster OX=7227 GN=Atxn7 PE=2 SV=1
18	Q8TD19	8.3	31.2	979	0.094	0.038	NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04977 DivIC	87	14.3	Septum formation initiator
2	PF19776 DUF6262	3.5e+02	12.8	Family of unknown function (DUF6262)
3	PF01486 K-box	51	15.5	K-box region
4	PF01166 TSC22	2.1e-24	96.8	TSC-22/dip/bun family
5	PF06156 YabA	42	16.2	Initiation control protein YabA
6	PF06005 ZapB	66	15.4	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300181

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233557	0.884	Nuclear receptor-binding protein
2	9606.ENSP00000327732	0.840	Uncharacterized protein C7orf61
3	9606.ENSP00000397435	0.800	TSC22 domain family protein 1
4	9606.ENSP00000354543	0.773	TSC22 domain family member 2
5	9606.ENSP00000275732	0.748	GRB10-interacting GYF protein 1
6	9606.ENSP00000263726	0.745	LIM/homeobox protein Lhx4
7	9606.ENSP00000305260	0.741	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
8	9606.ENSP00000171111	0.697	Kelch-like ECH-associated protein 1
9	9606.ENSP00000300179	0.649	Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 1
10	9606.ENSP00000360811	0.629	LIM/homeobox protein Lhx3
11	9606.ENSP00000361458	0.599	TSC22 domain family protein 3
12	9606.ENSP00000283109	0.575	Serine/threonine-protein kinase RIO2
13	9606.ENSP00000296509	0.572	Mitotic spindle assembly checkpoint protein MAD2A
14	9606.ENSP00000292330	0.550	Protein phosphatase 1 regulatory subunit 35
15	9606.ENSP00000414055	0.538	Nuclear receptor-binding protein 2
16	9606.ENSP00000312631	0.515	Insulinoma-associated protein 1
17	9606.ENSP00000365076	0.513	Uncharacterized protein C6orf47
18	9606.ENSP00000376071	0.506	Protein FAM117B
19	9606.ENSP00000381109	0.500	Zinc finger CW-type and PWWP domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0051252	0.967	regulation of RNA metabolic process
GO:0032502	0.954	developmental process
GO:0031326	0.948	regulation of cellular biosynthetic process
GO:0071840	0.947	cellular component organization or biogenesis
GO:0032501	0.940	multicellular organismal process
GO:0016043	0.929	cellular component organization
GO:0010556	0.894	regulation of macromolecule biosynthetic process
GO:0050896	0.844	response to stimulus
GO:0048856	0.831	anatomical structure development
GO:2001141	0.802	regulation of RNA biosynthetic process
GO:0009892	0.742	negative regulation of metabolic process
GO:0048523	0.740	negative regulation of cellular process
GO:0009890	0.707	negative regulation of biosynthetic process
GO:0010468	0.702	regulation of gene expression
GO:0006355	0.679	regulation of DNA-templated transcription
GO:0040007	0.674	growth
GO:0031324	0.618	negative regulation of cellular metabolic process
GO:0030030	0.616	cell projection organization
GO:0048869	0.518	cellular developmental process
GO:0030154	0.461	cell differentiation
GO:0051172	0.439	negative regulation of nitrogen compound metabolic process
GO:0010605	0.429	negative regulation of macromolecule metabolic process
GO:0006970	0.428	response to osmotic stress
GO:0006357	0.414	regulation of transcription by RNA polymerase II
GO:0009653	0.406	anatomical structure morphogenesis
GO:0048468	0.399	cell development
GO:0007275	0.366	multicellular organism development
GO:0010558	0.362	negative regulation of macromolecule biosynthetic process
GO:0031327	0.355	negative regulation of cellular biosynthetic process
GO:0016049	0.349	cell growth
GO:0048589	0.348	developmental growth
GO:0000902	0.346	cell morphogenesis
GO:0048588	0.340	developmental cell growth
GO:0042592	0.333	homeostatic process
GO:0048731	0.305	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0030054	0.997	cell junction
GO:0120025	0.990	plasma membrane bounded cell projection
GO:0036477	0.989	somatodendritic compartment
GO:0097447	0.978	dendritic tree
GO:0030425	0.972	dendrite
GO:0045202	0.967	synapse
GO:0005829	0.685	cytosol
GO:0070013	0.534	intracellular organelle lumen
GO:0031981	0.524	nuclear lumen
GO:0016020	0.507	membrane
GO:0005654	0.459	nucleoplasm
GO:0012505	0.377	endomembrane system
GO:0071944	0.355	cell periphery
GO:0005886	0.342	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]